KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2732Help
Entry
GY4MC1_2732       CDS       T01348                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gmc01001]
    GY4MC1_2732
Enzymes [BR:gmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GY4MC1_2732
Protein kinases [BR:gmc01001]
 Serine/threonine kinases: Other
  Bacterial family
   GY4MC1_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Seadorna_VP7 Kdo RIO1 FTA2 Haspin_kinase PBP1_TM Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ADP75428
UniProt: A0A0F6BPS7
LinkDB All DBs
Position
complement(2719156..2721123)
Genome map
AA seq 655 aa AA seqDB search
MLIGKRLNDRYKIIRLIGGGGMANVYLARDIILDRDVAVKVLRLDFANDEQFIRRFRREA
QAATSLNHENIVTIYDVGEDEGIYYIVMECVRGCTLKQYIHEHAPLPVPKALHIMEQLTS
AIAHAHENGIIHRDIKPQNILMDENGNVKVTDFGIAVALSSTTITQTNSVLGSVHYLSPE
QGRGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQTETPSPKAWNPSIPQS
VENIILKATAKDPFYRYRSAREMNEDIRTALDPERVNEQKFVIPADDEETTKAIPVIKEK
HVNAGSEQQTIVYEEKQEEEKRDEAKPKKKRKWLFVWLTALFLFLVAAGVSAVTWIPDLI
FPKEVTMPNVINKDYDKAVEQLSSLGLEIKDTIDVENDEIAEGKVVRTKPEAGMTVKQGS
AVVIYKSIGKKKVEFGNFIGQDIGIVEEQLKNENFMKITRKGRYSDKPLGTILDQFPYEG
DKVVPEETEVIFTVSLGPEKITLKDLTGYTEKSVRDYANDQQLHVNMQYEYSDKVPEGLV
ISQMPKANEKVDRGDTITIVISRGREPLPTKTVIKEIEIPYEPAEEGQVVEAQLYIQDAN
HNMTTPYKTYRLTGPVKETVTFEIPYKETAYYRVIVNNVVKDEGIIPYPDNRQKE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcggcaaacggttaaacgatcgttataaaatcattcgtttaattggcggcgga
gggatggcaaacgtttatttggcaagagacattattttagaccgcgacgtcgccgtgaaa
gtgttgcgcttggattttgccaatgatgaacagtttatccggcggtttcgccgtgaagcg
caagcggcaacgagtttaaatcacgaaaatatcgtcaccatttacgatgtcggggaagat
gaaggcatttattatattgtcatggagtgtgttcgtggctgtacattaaaacaatatatt
cacgaacatgccccccttccggttccaaaggcgcttcatattatggagcaattgacctcc
gcaatcgcgcacgcccatgaaaacgggattattcaccgcgatattaagccgcagaacatt
cttatggatgaaaacggaaatgtgaaagtcaccgatttcggaattgccgttgcccttagt
tccactacgattacgcaaaccaattcggtgctcggttctgtccattatttgtcgccagaa
caaggacgcggcggaatcgcgacagaaaagtcggacatttactctttaggaattgtcatg
tttgaattagtaacagggcggcttcctttttccggcgagtcagctgtatcgattgtgctc
aaacatttacaaacggaaaccccttctccaaaagcgtggaatcctagcattccgcaaagc
gtcgagaacattattttgaaagcgacggcgaaagatccgttttatcgctaccgttcagcg
cgggaaatgaatgaagatattcgcacggctttagatccggagcgcgtcaacgagcaaaaa
ttcgtgattccggctgatgacgaggagacgacaaaggcgattcccgttattaaagaaaaa
catgttaacgccgggagcgagcagcaaactattgtttacgaagaaaaacaagaagaagaa
aagagagacgaagcaaaaccgaaaaaaaagcgaaaatggctgttcgtctggctgactgcg
ttatttttgtttttggttgcagccggagtaagtgcggtcacgtggattcctgacttgatt
tttccaaaggaagtgacgatgccgaatgtcatcaataaggattatgataaggcggttgaa
cagttgtcgtcgctgggcctagagattaaagacaccattgacgtcgagaatgacgaaatc
gcagaaggaaaagtagtgcgcacaaagccggaagcgggaatgacggtaaaacaagggtcg
gctgtggttatttataaaagcatcggcaaaaagaaagtagagttcggcaattttatcggc
caagatataggaatagtggaagagcagctgaaaaacgaaaattttatgaagatcacgcgc
aaaggacgatacagcgataagccgcttggcacgattctcgatcaatttccttatgaagga
gacaaagttgttcctgaagaaacagaagtgatttttactgtcagtctcggcccggaaaaa
attacgctaaaagatttgaccggatatacggaaaagagcgtgcgcgattatgcgaatgac
cagcagctgcatgtgaacatgcagtacgaatattccgacaaagttccggaagggctcgtt
atttcacaaatgccgaaagcaaatgaaaaagtggacagaggcgatacgattacgatcgtt
atttcgcgcggcagggagccgcttcctacaaaaacggtgatcaaagagattgaaattccg
tatgaaccggcagaagaaggccaagtcgttgaagcacaattatatattcaagatgccaat
cataacatgacgacgccgtataaaacataccgtttgaccggaccggtgaaagagacggtg
acatttgaaatcccatataaggaaaccgcgtattatcgcgtcattgtcaacaatgtagta
aaagacgagggaatcattccatatccagacaatcgtcaaaaggagtga

DBGET integrated database retrieval system