KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3131Help
Entry
GY4MC1_3131       CDS       T01348                                 

Definition
(GenBank) ComK family protein
  KO
K02250  competence protein ComK
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GY4MC1_3131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gmc03000]
    GY4MC1_3131
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gmc02044]
    GY4MC1_3131
Transcription factors [BR:gmc03000]
 Prokaryotic Type
  Other transcription factors
   Others
    GY4MC1_3131
Secretion system [BR:gmc02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   GY4MC1_3131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: ADP75808
UniProt: A0A0F6BQV7
LinkDB All DBs
Position
complement(3121777..3122319)
Genome map
AA seq 180 aa AA seqDB search
MKVNEFIILDQFIISRYTMAVLPHHLHGNSYAKVVEEDGEYVVKMRPLDIIKRSCDYYGA
SFRGRRDGTRAVIGVTHKAPIAIEPLNEIYVFPTISPNDSRCVWISHLHVYKYEPTKNDQ
TIVYFANEKSLLLDVSYYSFMNQLYRTAQLRTKLSERMEARERKLQYVFRMDRSNGWQQR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaacgagtttatcatcttggatcaatttattataagccgctataccatggcg
gttttgccgcatcacttgcacggcaattcgtatgctaaggttgtggaagaagatggcgag
tatgttgtcaaaatgcggccgcttgatattattaaacgcagctgcgactattacggcgct
agctttcgaggcaggagagacgggacgagagctgtcattggcgttacgcataaagccccg
atcgcgattgaaccgctcaatgaaatttacgtttttccgacgatttcccctaacgattcc
cgctgcgtatggatttctcaccttcacgtatataaatatgaacccacaaaaaatgaccag
acgatcgtctatttcgccaatgaaaaaagtcttttgcttgatgtttcctattactctttt
atgaatcagctttatcgcacggcacagctgcggacgaaattatcagagcggatggaggcg
agagaacgtaaattgcaatatgtatttcgcatggatcgctctaatggatggcagcagcga
taa

DBGET integrated database retrieval system