KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3588Help
Entry
GY4MC1_3588       CDS       T01348                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00473  D-Alanine metabolism
gmc01100  Metabolic pathways
gmc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GY4MC1_3588
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GY4MC1_3588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gmc01011]
    GY4MC1_3588
Enzymes [BR:gmc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GY4MC1_3588
Peptidoglycan biosynthesis and degradation proteins [BR:gmc01011]
 Precursor biosynthesis
  Racemase
   GY4MC1_3588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADP76228
UniProt: A0A0F6BS27
LinkDB All DBs
Position
complement(3580655..3581800)
Genome map
AA seq 381 aa AA seqDB search
MFYRDTWAEIDLDAIYYNVSQLKNFLPNDVRIMAVVKANAYGHGDVQVAKTALEAGASYL
AVAFLDEALALRKGGIDAPILVLGASRPSDINIAAKHRITLTVFQAEWIEQAADFYSETA
PVLFHLKMDTGMGRLGVKEETETKRLIEQIDRHPYFSLEGVYTHFATADEINTGYFSFQY
DNFLRMLEWLPYKPPLIHCGNSATTLRFPDKVFNMARFGISMYGLSPSPEIKQYLPYTLK
EAFSLHSRLVHVKKLKPGEKVSYGATYTAETEQWVGTVPIGYADGWLRKLQNFHVLVNGE
KAPIIGRICMDQLMVRLPKQLPVGTKVTLIGRQGDKYISVDDVAQYLDTINYEIPCTISY
RVPRIFFRNKSIMEVRNLVYA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttttaccgcgatacttgggcagaaattgatttagacgcgatttactataacgtttca
caactgaaaaattttttgccaaacgatgtccgcatcatggcggtggtgaaggcgaacgct
tacggccacggtgatgtgcaagtggcaaaaactgcgctcgaggcaggggcctcttatttg
gcagtagcgtttttggatgaagcgctcgcattgcgaaaaggcggaattgacgctccgatt
ctcgtgctgggagcttcccggcctagcgatattaatatcgctgcaaaacaccggattacg
ctcaccgtgttccaggcagaatggattgaacaagcggcagatttttacagtgaaacggcg
cctgttttgtttcatttaaaaatggatacgggaatggggcggctcggggtgaaagaggaa
acagaaacgaagcgcctcattgaacaaattgaccgccatccgtatttttcgctagaaggc
gtttatactcattttgccacagccgatgaaatcaacacgggttatttttcttttcaatac
gataattttttacggatgctcgaatggcttccatataaaccgcctcttattcattgcggg
aacagcgcgacgacgttgcggtttccggataaagtgtttaatatggcgcgttttggcatt
tcgatgtatggactatctccttcaccggaaataaaacaatatttgccatatacgttaaag
gaagccttttcattgcatagccgccttgttcatgtgaaaaagctgaagccgggagaaaag
gtaagctatggcgcgacatatacggcagaaacggagcaatgggtcggcacagttccaatt
ggatatgcggatggttggttgcgtaagctgcaaaactttcatgtgcttgttaatggagaa
aaagcgccgattattggaagaatttgcatggatcagttgatggtccgcctgccaaagcag
ctgccagtcggaacgaaagtgaccttgattggccggcaaggtgacaaatatatttctgtt
gatgatgttgcacaatacttggatacgattaattatgaaattccttgtacaatcagttat
cgtgttccccgtatttttttccgaaataagagtataatggaagtgagaaatcttgtttat
gcataa

DBGET integrated database retrieval system