KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3722Help
Entry
GY4MC1_3722       CDS       T01348                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GY4MC1_3722
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GY4MC1_3722
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GY4MC1_3722
    1.1.1.-  
     GY4MC1_3722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_N_assoc ADH_zinc_N_2 F420_oxidored BRCA2 Orthopox_35kD
Motif
Other DBs
NCBI-ProteinID: ADP76347
UniProt: A0A0F6BSE6
LinkDB All DBs
Position
complement(3715055..3716107)
Genome map
AA seq 350 aa AA seqDB search
MKAARWYNARDIRVEEVEEPKAGKGKVKIKVEWAGICGSDLHEYAAGPIFIPVQNPHPVS
KDVAPIIMGHEFSGRVVEVGEGVTKVKVGDPVVVEPILRCGECPACKKGKYNLCEHLGFH
GLSGGGGGFSEYTVVDEYMVHKMPEGLSFEQGALVEPAAVALHAVRSSKIKPGDKAAVFG
TGPIGLLVMEALKAAGASEIYAVEVSKERLQKAKELGATSVINPKEEDPVRKLVELTGGG
VDVSFEVTGVPAVLQQAIDSTAFEGETVIVSIWEKEAGIQPNNIVLKERNVKGVIAYRDI
FPAVMELMKRGYFQAEKLVTKRIKLDDIVAEGFEALIKEKDQVKILVKPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgatggtacaatgctagagacattcgagtggaagaagtagaagaaccg
aaagcaggaaaaggaaaagtaaaaattaaagtcgaatgggcgggaatttgcggaagcgat
ttgcacgaatatgcggcaggtccaatttttatccctgtccaaaatcctcatcccgttagt
aaagatgtcgccccgattatcatgggccacgaattttcgggccgagtagtagaagtcggg
gaaggagttactaaagtcaaagttggggatcctgtcgttgttgaaccgattcttcgttgt
ggagaatgcccggcttgcaaaaaagggaaatacaatctttgcgaacatttaggattccat
ggcctgtccggaggaggcggcggattctcagaatataccgtcgttgatgaatatatggtg
cacaaaatgcctgaaggtctttcttttgaacaaggagcgctggtggaaccggcggctgtc
gcgttacatgctgtcagatcaagcaaaatcaaacctggtgataaagctgccgtttttgga
acaggaccgataggccttcttgtgatggaagcattgaaagcggctggcgcctcggaaatt
tatgcagtcgaagtttccaaagaacgtttgcaaaaagcgaaagagcttggcgccacatct
gtcatcaatccaaaagaagaagatccggttcgcaaacttgtcgaattgaccggtggcggc
gtcgatgtttcgtttgaagtaacgggggtgccggccgttttgcagcaagctattgacagc
actgcattcgaaggagaaacggttatcgttagtatatgggaaaaagaagcaggcattcag
ccaaacaatattgtattaaaagaaagaaatgtgaagggagttattgcataccgcgatatt
ttccctgctgtaatggaattaatgaaacgaggctatttccaagctgaaaagcttgttacg
aaacgaatcaagctggatgatatcgtggcagaaggatttgaagcgctcattaaagaaaaa
gaccaagtgaaaattttggtcaaaccagaataa

DBGET integrated database retrieval system