KEGG   Geobacter metallireducens: Gmet_0680Help
Entry
Gmet_0680         CDS       T00295                                 

Gene name
draG
Definition
(GenBank) ADP-ribosyl-(nitrogenase)-activating glycohydrolase
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
gme  Geobacter metallireducens
Brite
KEGG Orthology (KO) [BR:gme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Gmet_0680 (draG)
Enzymes [BR:gme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     Gmet_0680 (draG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-ProteinID: ABB30922
UniProt: Q39XV2
LinkDB All DBs
Position
complement(746445..747347)
Genome map
AA seq 300 aa AA seqDB search
MPHLLDHHDIRSRARAAFIGLAVGDALGAPVEFMTAGEIRSKYGVLREIVGGGWLRLKPG
QVTDDTEMSLCVARAIVAAGGWSLRGIAEEFAGWLRTKPVDVGDTCRRGIRNFMLKGSLE
TPFNQWDAGNGAAMRMLPAALYTLGDDDLLQRCALEQARITHNHPLSDAACITLGRIVHL
ALRGASKNRLHREADLLVADLPAFTFTPYRGLATGYVADTVQTVFHHFFRGRSFEECLVG
TVNQGGDADTTGAICGMVAGAFYGMEGIPQRWLKKMDRKTMAEIAELSTRLIALSTPLRE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccccacctcctcgatcatcacgatatccgctcccgggcccgggccgccttcatcggg
ctggcggtgggagacgccctcggcgcgccggtggaattcatgacggccggggagatacgg
tccaagtacggcgtcctgcgggagatcgtcggtggcggatggctgcggctcaaaccgggc
caggtgaccgacgacaccgagatgtctctctgcgtggcccgggccatcgttgccgctggc
ggatggtccctgcgcggcatcgccgaagagttcgccggatggctcaggacaaaaccggtg
gatgtgggggacacctgtcgccggggcatccggaacttcatgctcaagggaagcctcgaa
acccccttcaaccagtgggacgccggcaatggcgccgccatgcggatgctcccggcggcc
ctctacaccctcggcgacgatgacctcctgcagcgctgcgccctggagcaggcccgcatc
acccacaaccaccccctttccgacgccgcctgcatcaccctcgggcgcatcgtccacctg
gcgctccgaggcgcatccaagaaccgtctccaccgggaggcagacctcctcgtcgccgac
cttcccgccttcaccttcaccccttaccggggactcgccaccggctacgtggccgacacc
gtacagaccgttttccaccatttcttccggggacgcagcttcgaggaatgcctcgtggga
accgtgaaccaggggggggatgccgacaccaccggtgccatctgcggcatggtggccggg
gcattctacgggatggagggaattccccaaaggtggctaaagaaaatggatcgaaaaacc
atggccgaaatcgcagagctttctactcgcctaatcgccctgtcaacgccccttcgcgaa
taa

DBGET integrated database retrieval system