KEGG   Geobacter metallireducens: Gmet_0938Help
Entry
Gmet_0938         CDS       T00295                                 

Gene name
pfk-2
Definition
(GenBank) 6-phosphofructokinase, ATP-dependent
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gme  Geobacter metallireducens
Pathway
gme00010  Glycolysis / Gluconeogenesis
gme00030  Pentose phosphate pathway
gme00051  Fructose and mannose metabolism
gme00052  Galactose metabolism
gme00680  Methane metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01130  Biosynthesis of antibiotics
gme01200  Carbon metabolism
gme01230  Biosynthesis of amino acids
gme03018  RNA degradation
Module
gme_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gmet_0938 (pfk-2)
   00030 Pentose phosphate pathway
    Gmet_0938 (pfk-2)
   00051 Fructose and mannose metabolism
    Gmet_0938 (pfk-2)
   00052 Galactose metabolism
    Gmet_0938 (pfk-2)
  09102 Energy metabolism
   00680 Methane metabolism
    Gmet_0938 (pfk-2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Gmet_0938 (pfk-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gme01009]
    Gmet_0938 (pfk-2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gme03019]
    Gmet_0938 (pfk-2)
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gmet_0938 (pfk-2)
Protein phosphatases and associated proteins [BR:gme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gmet_0938 (pfk-2)
Messenger RNA biogenesis [BR:gme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gmet_0938 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABB31180
UniProt: Q39X44
LinkDB All DBs
Position
complement(1039789..1040748)
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRAAVRTAIRLNIEVVGFRKGYLGLMKGDAIPLDTKAVSGI
LHRGGTFLQSARSPEFKTPEGQQKAIDNLKELGVEGLVVLGGDGSLTGALALHRLGLPVV
GIPSSIDNDIPYTDMALGVDTALNNIIYAVDCIKDTASSHARAFVIEVMGRNSGYLASIS
AIATGAEFALVPEREYDLAEICQQLRARFEEGRDNAIIILAEGAGHAREISDSIKDAIGF
ETRITVLGHYQRGGAPTVFDRLLASRFGKRAVELLISGNSGVMVGLSCNAILATPLEDVI
KGEKRPQDEVLRLAEVLGV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcggcattctcacgagcggcggcgactgctccggcatgaacgccgccatc
cgggcggcggtacggaccgcgatccgcctgaacatcgaggtggtgggattcagaaaggga
tatctggggctcatgaagggggatgccatccccctcgacaccaaggcggtttcgggcatc
ctccaccggggtgggacgttcctccagtcggcccgctcgccggaattcaagacccccgag
gggcagcagaaggccatcgacaacctgaaggagttgggcgtcgaaggactcgtggtgctc
ggtggcgacggctccctaaccggcgccctggcgctccaccggctcggcctgccggtggtc
ggcatcccgtccagcattgacaacgacatcccctacaccgacatggccctcggtgttgat
acggccctcaacaacatcatctacgccgtcgactgcatcaaggatacggccagctcccac
gcccgggcctttgtgatcgaggtcatggggcgcaactcggggtacctggccagcatctcc
gccatcgccaccggtgccgagttcgccctggtccccgaacgggaatacgacctggccgag
atctgccaacagctccgagcacgcttcgaggaggggcgcgataacgccatcatcatcctc
gccgaaggcgccggccatgcccgggagatctccgacagcatcaaggacgccatcggcttc
gagacgcggatcacggtgctgggccactaccagcgcggcggcgcgccgaccgtcttcgat
cggctcctggcaagccgtttcggcaagcgggcggtggaactcctcatctccggcaactcc
ggggtgatggtgggactttcctgcaatgccattctcgccacgcccctggaagacgtcatc
aaaggcgagaaacgcccccaggacgaggtattgcggctggcagaggtgttaggtgtttag

DBGET integrated database retrieval system