KEGG   Geobacter metallireducens: Gmet_1644Help
Entry
Gmet_1644         CDS       T00295                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gme  Geobacter metallireducens
Pathway
gme00250  Alanine, aspartate and glutamate metabolism
gme00410  beta-Alanine metabolism
gme00430  Taurine and hypotaurine metabolism
gme00650  Butanoate metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Gmet_1644
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gmet_1644
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gmet_1644
   00430 Taurine and hypotaurine metabolism
    Gmet_1644
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Gmet_1644
Enzymes [BR:gme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Gmet_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABB31875
UniProt: Q39V49
LinkDB All DBs
Position
1845016..1846668
Genome map
AA seq 550 aa AA seqDB search
MPKNRDAARASLENLYRIFTVPEAPDSTLGAIDQAIAGDVAGFLQTHIVAIERPLEEIEA
DFSSFSIPEEPTYVSEYTEFVKENLVAHSVHTASPAFVGHMTSALPYFMLPLARLMTALN
QNVVKVETSKAFTPMERQVLAMLHHLVYGRNDDFYPQWIHNSQHALGAFCSGGTLANVTA
LWVARNRLFAPDGEFRGIAQEGLARALKHRGADGIAVLVSERGHYSLGKAADLLGIGRDD
LIKIKTDANNRIDLKALREECRRLQDRNTLPLALVGIAGTTETGNVDPLEAMADLAQELG
CHFHVDAAWGGPTLFSDRHRHLLRGIERADSVTIDGHKQLYVPMGAGMVVFKDPTALSAI
EHHANYILRHGSKDLGSHTLEGSRPGKAMLVHAGFSIIGRKGYELLIDMGIERARTFADM
IQRHPDFELISEPELNILTYRYCPPAIQQALTDATAQQRAAINGLLDQVCQLLQKYQREA
GKTFVSRTRLHVARHDMELTVLRVVLANPLTTDEILEAVLAEQCEIVRLPEIQALLRQAE
ELCPGLAKAV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaatcgtgatgcagcccgtgccagcctggaaaacctctaccggatcttcacc
gtgccggaagcacccgactcgaccctcggcgctattgatcaggcgattgccggcgatgtc
gccggcttcctgcagacccatatcgtcgccatcgaacgccctctcgaagagatcgaagcg
gatttctcctccttctccatacccgaggaaccgacctacgtctccgagtataccgaattc
gtcaaagagaacctcgtcgcccactcggtccataccgcctcaccggcctttgtcggccac
atgacctcggcgctcccctacttcatgctcccgctggcacgcctcatgaccgccctcaac
cagaatgtggtcaaggtggagacatccaaggcctttacgcccatggagcgccaggtcctt
gccatgcttcatcacctggtctatggccggaatgacgacttctacccgcaatggattcat
aacagccagcatgccttgggggccttctgctccggcggcaccctcgccaacgtcacggcg
ctatgggtggcgcgcaaccgcctgttcgctccggacggagagttccgcggcattgcccag
gaagggttggcccgtgccctgaaacatcgcggcgcggacgggattgccgttctcgtttcc
gagcgcggccactactctttgggcaaggccgccgacctcctcggtatcggcagggatgac
ctgattaagataaagacggatgcaaacaaccgtatcgacctcaaggcgttgagagaagaa
tgccggcgactgcaggatcggaacaccctcccgctggctctggtcggcatcgccgggacg
accgaaaccggcaacgtcgacccgctggaggcaatggccgatttagcccaagagctcggc
tgtcattttcatgtggatgccgcctggggggggccaacccttttttccgaccggcaccgt
cacctgctccgcggaatagaacgggccgactcggttaccattgacgggcacaaacagctc
tatgtgccgatgggggcggggatggtcgtcttcaaggatcccaccgccctctcggctatc
gagcatcatgccaactatatcctgcgtcatggctccaaggacctgggcagtcataccctg
gaagggtcgcggccagggaaggcgatgctggttcatgccgggttttcgatcattggccgc
aaggggtacgagcttcttatcgatatggggatcgagcgggcacgcacctttgccgacatg
atccagcgccatcccgatttcgagctgatcagcgaaccggaactgaatattctcacctac
cgctactgtccgcctgccatccagcaggccctgaccgacgcgacggcccaacagcgcgcc
gcaatcaatggacttcttgatcaggtctgtcagctgttgcagaaatatcagcgcgaagcg
ggtaaaacctttgtctctcgaacacggctgcatgtggctcgccacgacatggagctcacg
gtcttacgtgtcgttctggccaatccgctgacgaccgatgagattctggaggcagttttg
gcggaacaatgcgaaatcgtgcgtctgccggagattcaggccttgctgcggcaggctgag
gaactctgtcccggtctggcgaaagctgtctaa

DBGET integrated database retrieval system