KEGG   Geobacter metallireducens: Gmet_1677Help
Entry
Gmet_1677         CDS       T00295                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, FAD-dependent
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gme  Geobacter metallireducens
Pathway
gme00564  Glycerophospholipid metabolism
gme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Gmet_1677 (glpA)
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Gmet_1677 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 HI0933_like GIDA Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABB31908
UniProt: Q39V16
LinkDB All DBs
Position
1884413..1885963
Genome map
AA seq 516 aa AA seqDB search
MTRTRLLQQLEEEKCWDLLVIGGGATGLGVAVEGASRGYRTLLLERDDFGSGTSSRSTKL
IHGGVRYLQQGNLSLVLEALHERGILIRNAPHLVHNLSFVVPLYDWWEGPFYGIGLKLYD
MLAGKLGLGPSQILSREETLRRIPTVEPAGLRGGVIYHDGQFDDARLAVALARTCADLGG
VPLNRMEVAGLLKGDGLVRGVAARDRESGREYEIEARVVVNATGPSCDAIRQLDDPGAQP
VIAPSQGVHLVLPREFLPGDSAIMVPHTDDGRVLFAVPWHERVIVGTTDTPVERVTAEPR
PLAAEVGFLLEHAARYLSRDPATSDILSVFAGLRPLVRGEAVNTAALSRDHTIMVSTAGL
VTITGGKWTTYRRMAEDTVNSAVRMAGLAERPSRTADLPIHGWLAKGGVDGEWAMYGAEA
AALEELCAVQPALRRQLHPRLPYRLAEVVWGVRYEWARSVEDVLSRRTRALILDARAAME
AAPEVAALMATELGRDEAWQAAEVAAFRALAEGYLP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtacgaggctcttgcaacagcttgaagaggagaagtgctgggatctcctcgtt
atcggcgggggcgccaccgggctcggcgtggccgttgagggggcgagccggggctaccgg
acgctcctcctggagcgtgacgacttcggcagcggcacctccagccggagcaccaagctc
atccacggcggggtccggtacctgcagcaggggaatctctccctggtactggaggccctc
cacgagcggggaatcctgatccgcaacgccccgcacctggtgcataacctctccttcgtg
gtcccgctctatgactggtgggaaggtcccttctacggcatcggactgaagctctacgac
atgttggcgggaaagctgggactcggcccgtcgcagatactctcccgggaggagaccctg
cgccgcatccccaccgtggagccggcagggttgcggggcggggtgatctaccacgacggc
cagttcgacgatgcccggcttgccgtggccctggcccgcacctgcgcggacctgggggga
gttcccctgaaccgcatggaggtggcaggcctcctcaagggggatggcctggtccgcggc
gtagcggcccgggaccgggagagcggccgcgaatacgagatcgaggcgcgggtggtggtg
aatgccaccgggccctcctgcgacgccatccgccagctggacgaccccggcgcgcagccg
gtcattgctccgagccagggggtgcatctggtcctgccccgggaattcctccccggcgac
agcgccatcatggtcccccacaccgacgacgggagggtgctcttcgccgtcccctggcac
gaacgggtgatcgtcggcaccaccgacacgccggtggagcgggtcacggccgaaccccgt
cccctggcggctgaagtggggttcctcctggaacatgcggcccggtatctctcccgggat
cccgccacgtccgacatcctcagtgtcttcgccgggctccgccccctggtgcggggtgaa
gcagtcaatacagcggccctttcccgtgatcacaccattatggtttcgaccgccggtctg
gtcaccatcaccggcggcaagtggaccacctaccgcaggatggccgaggatacggtaaac
agcgctgtcaggatggcggggctggcagagagaccgtcgcgcacggccgacctccccatc
cacgggtggctggccaaggggggtgttgacggggagtgggcgatgtatggcgccgaagcc
gctgccctggaagagctgtgcgccgtgcaaccggccctgcgccggcaactccatccccgg
ctcccgtaccggctggccgaggtggtctggggggtgcggtacgaatgggcgcggagtgtt
gaggatgtgttgagccgccgtacccgggcactcattctcgatgcccgtgccgccatggag
gcggccccggaggttgccgccctgatggcgacggaactggggcgcgatgaggcctggcag
gcggcagaggttgcggcttttcgcgccctggctgaggggtatctgccttag

DBGET integrated database retrieval system