Geobacter metallireducens: Gmet_2286 Help Entry Gmet_2286         CDS       T00295                                  Name (GenBank) FlgM family protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism gme  Geobacter metallireducens Pathway gme02020   Two-component system gme02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:gme00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Gmet_2286  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Gmet_2286  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:gme02035]     Gmet_2286 Bacterial motility proteins [BR:gme02035]  Flagellar system   Flagellar assembly proteins    Others     Gmet_2286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM PilN Motif Other DBs NCBI-ProteinID:  ABB32511 UniProt:  Q39TB3 LinkDB All DBs Position complement(2591460..2591765) Genome browser AA seq 101 aa AA seqDB search MKIDDKPILPATVATRSEAAAALADGDIHRSAAQGQGEDTVQLSGNAERVARMSEALQKI PDIRVERVQELKRQVAAGEYAVSARDVAEKMLMTMKKGVAV NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaaaattgacgataagcccatactcccagcaacggtagcaaccagaagcgaagccgcc gcggcgcttgccgacggcgatatccataggagcgccgcccaggggcagggagaggatacg gtgcaactttccggcaatgccgaacgggtagcccgtatgagtgaggcccttcagaagatt cccgacatccgggtggagcgggtccaggagctcaaaaggcaggtggctgccggtgaatac gccgtgagcgcccgcgacgtggccgaaaagatgctcatgaccatgaagaaaggggtcgct gtctga

DBGET integrated database retrieval system