KEGG   Geobacter metallireducens: Gmet_3159Help
Entry
Gmet_3159         CDS       T00295                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gme  Geobacter metallireducens
Pathway
gme00500  Starch and sucrose metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gmet_3159
Enzymes [BR:gme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Gmet_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABB33372
UniProt: Q39QV2
LinkDB All DBs
Position
3555314..3557878
Genome map
AA seq 854 aa AA seqDB search
MDFTKGMHRFTVVPSLTGELARLQTIAYNLWWTWEPEAVELFKRLDIDLWQQTRHNPVEM
LGILQQTTLDKLTTDEGFMSQLKQVDEKFREYLSARTWFERTCNGGRPMSVAYFSMEFGI
HESLPTYSGGLGILAGDHLKSASDLGIPLVGVGLLYRQGYFRQYLNIEGWQQELYPENDF
YNLPLTLERDASGAPLAVELNMPSRKVTAHIWRVQVGRVPLYLLDTNLEENAPEDREITA
QLYGGDLEMRIRQEILLGIGGIRALHLLGITPNVCHMNEGHAAFLALERTRLLMEEHGIR
FAEAMEAVRAGNVFTTHTPVDAGIDHFPPDLLEKYLGRYYRFLGLSRDEFLALGRINPKN
SHEAFCMAVLALKLADHANGVSQLHGEVSRLMWKNLWPELPDEHIPITSVTNGVHTKTWL
SNEMAGLLTRYLGNRWREDATDPLLWKRVAHIPESELWRTHERCRERLVLFARRRLKDHL
KQVGATAKEIAQADEVLDPEALTIGFARRFATYKRGTLLFRDLARLEKILGSTDRPVQII
FAGKAHPHDTEGKELIREIFQHSLDSRFRGRIVFIEDYDMAVARHLVQGVDVWLNTPRRP
LEASGTSGMKVAFNGGLNMSILDGWWPEGYQGNNGWAIGKGEVYDDLDYQNEVEGRAIYD
LLEKEVVPLFYDRGPDGIPRGWLAFMKASLQTLCPLFSTERMVQEYTRTMYRPSFAHWEM
LSADGLALAVDLAGWKGDIRRTWHQVRIAGIEAKTPTEVPLGAVIPVTVNIILGDIPPDQ
LSADLYCGVLDSRGNIVGGELVPLAWEEATGDGAHRFYGEIESRFCGRHGFMVRVMPRHP
KLGPVYEQGSIAWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaccaagggaatgcaccgttttaccgttgtcccgtcgctgaccggcgaactg
gccagactccagaccatcgcctacaacctctggtggacttgggagcccgaggcggtggag
ctcttcaagcggctcgacatcgacctctggcagcagacccgccacaacccggtggagatg
ctcggtatcctccagcagaccaccctcgacaagctcaccaccgacgagggattcatgtcc
caattgaaacaggtggatgagaagttccgggaatacctctcggccaggacctggttcgag
cggacctgcaacggcggcaggcccatgtccgtcgcttacttctccatggagttcggtatc
cacgagtcgctccccacctattcggggggactcggaatcctggccggcgaccacctgaag
tcggccagcgacctggggattcccctggtaggagtcggactcctctaccggcagggctac
ttccgccagtacctgaacattgaggggtggcagcaggaactctaccccgaaaacgacttc
tacaacctccccctcaccctggagcgggatgcttccggcgcccccctggccgtggaactc
aacatgccaagccgcaaggtgacggcccacatctggcgggttcaggtggggcgggtcccc
ctctacctcctggacacgaacctggaggagaacgcccccgaggaccgggagatcacggcc
cagctctacggcggcgacctggagatgcggatccggcaggagatcctcctggggatcggc
ggcatccgggccctccacctccttgggatcacccccaacgtctgccacatgaacgagggg
cacgcggcgtttctggccctggagcggacccgcctcctcatggaagagcacggcatccgg
ttcgccgaggccatggaggcggtgcgggccggcaacgttttcaccacccacaccccggtg
gatgccggcatcgaccactttccccccgatctcctagagaagtacctggggcgctactac
cgcttcctgggcctctcccgggacgagttcctggccttgggacggatcaaccccaagaac
tcccacgaagcgttctgcatggcggtcctggccctcaagctggccgaccatgccaacggc
gtctcccagctccatggcgaggtgtcgcggctcatgtggaagaacctctggcccgagctc
cccgacgaacatatccccatcacctcggtcaccaacggagtccacaccaagacctggctc
tccaacgagatggcggggctcctcacccggtacctcggcaaccgctggcgcgaggacgcc
accgatcccctgctctggaagcgggtcgcccacatccccgaatcggagctctggcggacc
cacgaacggtgccgcgagcggctcgtcctcttcgcccgccgccgcctcaaggaccacctg
aagcaggtgggggccacggcaaaagagatcgcccaggccgacgaggttcttgacccggaa
gccctcaccattggctttgcccgccgcttcgccacctacaagcgagggacccttctcttc
cgggacctggcgcggctggaaaaaatcctggggagcaccgaccggccggtgcagatcatc
tttgccggcaaggcccacccccacgacaccgaagggaaggagctgatccgggagatcttc
cagcattccctcgacagtcggttccggggacggatcgtcttcatcgaggactacgacatg
gccgtggcccggcacctggtccagggggtcgacgtctggctcaacaccccccgccgcccc
ctggaggccagcggcaccagcggcatgaaggtggccttcaacggcggcctcaacatgagc
atcctcgacggctggtggcccgaggggtaccaggggaacaatggctgggccatcggcaaa
ggagaggtctacgacgacctcgattaccagaacgaagtagagggacgggccatctatgac
ctgctggagaaagaagtggtccccctcttctacgaccggggccccgacggcatcccccgc
ggctggctcgccttcatgaaggcaagcctccagaccctctgcccccttttcagcaccgag
cggatggttcaggagtacaccaggaccatgtaccgtccctccttcgcccactgggagatg
ctctcggcggacggcctggccctggcagtggatctcgccggctggaagggggatatccgc
cgcacctggcaccaggtaaggattgcggggatcgaagccaagacccccaccgaggtcccg
ttgggggcggtaattccggtgacggtgaacattatcctcggcgacatcccccccgaccag
ctttccgcggatctctactgcggggtcctggactcccgagggaacatcgtcggaggagaa
ctggttccccttgcctgggaagaagcgacaggggacggtgcccaccgcttctacggcgag
atcgagagccgcttctgcggcaggcacggcttcatggtgcgggtcatgccccgccacccg
aagctggggccggtctacgagcagggaagtattgcgtgggggtga

DBGET integrated database retrieval system