KEGG   Geobacter metallireducens: Gmet_3469Help
Entry
Gmet_3469         CDS       T00295                                 

Gene name
treS
Definition
(GenBank) trehalose/maltose transglucosylase and maltokinase, putative
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gme  Geobacter metallireducens
Pathway
gme00500  Starch and sucrose metabolism
gme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gmet_3469 (treS)
Enzymes [BR:gme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Gmet_3469 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Gmet_3469 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Caskin-Pro-rich
Motif
Other DBs
NCBI-ProteinID: ABB33678
UniProt: Q39PZ6
LinkDB All DBs
Position
3887532..3890870
Genome map
AA seq 1112 aa AA seqDB search
MARREPLRGGNPLWYRDAIIYQLHVKAFADSDGDGMGDFRGLMGKLDYLQSLGITAIWIL
PFYPSPLRDDGYDIADYYSVNPSYNTLREFREFLRAAHARRIRVITELVLNHTSDQHPWF
QRARRAKPGSAHRDYYVWSDNPDRYQGTRIIFQDFETSNWSWDPVAKAYYWHRFYSHQPD
LNYDNPKVQAEMLRVIDYWLGMGVDGVRLDAVPYLFEREGTNCENLPETHAFLKKLRAHV
DASFPNRMLLGEANQWPEDAIAYFGEGDECNMLFHFPLMPRMYMAIEMEDRFPVIDIIDQ
TPAIPEGCQWAIFLRNHDELTLEMVTDEERDYMYRIYAADPKARINLGIRRRLAPLMERD
RRKIELMNALLFSLPGTPIIYYGDEIGMGDNYYLGDRNGVRTPMQWSPDRNAGFSGANPQ
RLYLPVIIDPEYHYEAVNVEIQERNPTSLLWWMRRTIAVRRRHRAFSSGTLEMLYPANHR
VLAFLRRHEDEVILVVGNLSRFAQAVSLDLKEFAGISPADLFSRNRFPVIREIPYPLTLG
PHDHFWFILSRAESPRLPEGELPRINLPGGLPWWEALQHTGGDTRLERATTDYLNRSGWF
RGKARAIIGYALRDTVLLRTSDQVFPLFFLEVRYQNGAPETYLIPVAFLRGPGAKRVDAE
SPQAAIASLSVGDEAGILCDALHDREFRDALLALALGRRRLHGKRESLVVPLHGRGGHAE
GMRETEHLISELVTGEEASSVILYGDRHVFKLYRTVEPGVNSEVELVRFLTEKSRYPNIV
PFQASLELRHPGTEPCTIGLVQEYVKNQGNGWRLALHLLGQYFERILSRRGEIPPPPKRF
SSLIDGSACTVPEPVANLIGGFYLEMAGLLGRRTAELHLALAAGGNDPAWKPEAYSTIYQ
RSVYQSMRNQARRTLQLLSQNRNLLPIDDQGPADRVLGAEKEILSWLAQIVGRRIGTMKI
RIHGNFHLGKVLFTGKDFVILDFEGEPDRTLSERRIKRSPLRDVASMIRSFHAATLTALA
RHGNGRSGDVQLLEPWADACYYHVSCRYLAGYLERMGNSPLVPADRNDLATLLRSFLLDR
ALRDLGFALGNRPETASSPLKGIETVLREYGE
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagagaaccgttgcggggcggcaatcccctctggtaccgggacgccattatc
taccagctccacgtcaaggccttcgccgactcggacggcgacggcatgggggacttccgg
ggcctcatggggaagctcgactatctccaatccctggggatcaccgccatctggatcctc
cccttctacccttcgccgctacgggatgacgggtacgacatcgccgactattacagcgtg
aaccccagctacaacaccctgcgggaattccgggagttcctccgggcggcacacgcccgc
cgcatccgggtcatcactgagctggtcctcaaccacacctcggaccagcacccctggttc
cagcgggcccgccgggccaaaccgggatcggcccaccgcgactactacgtctggagtgac
aaccccgaccgctaccaaggaacccggatcatcttccaggacttcgaaacctccaactgg
agctgggatccggtggccaaggcctactactggcaccggttctactcccaccagcccgat
ctcaactacgacaaccccaaggtccaggcggagatgctccgggtcatcgactactggctc
gggatgggagtggacggggtgcgcctcgacgcggtcccctacctcttcgagcgcgagggg
accaactgcgagaacctccccgaaacccacgccttcctgaagaagctccgggcccacgtg
gacgcctcgttccccaaccggatgctcctcggcgaggccaaccagtggcccgaagacgcc
atcgcctacttcggcgagggggacgagtgcaacatgctcttccacttccccctcatgccc
cgtatgtacatggccatcgaaatggaggaccgcttccccgtaatcgacatcatcgaccag
acccccgccatccccgaggggtgccagtgggccatcttcctccgcaaccacgacgagctg
accctggagatggtcaccgacgaagagcgggactacatgtaccggatctacgccgccgac
ccgaaagcgcggatcaacctggggatccggcggcgcctcgctccgctcatggagcgggac
cggcggaagatcgagctgatgaacgcccttctcttctcgctccccggcacccccatcatc
tactacggcgacgagatcggcatgggggacaactactacctgggggaccgcaacggcgtc
cgcacccccatgcagtggagccctgaccgcaacgccggcttctccggcgccaacccccag
cggctctacctgccggtcatcatcgaccccgaataccactacgaggcggtaaacgtggag
attcaggagcgcaaccccacgtcgctcttatggtggatgcgccgcaccatcgccgtgcgc
cgccgccaccgggccttcagcagcggcaccctggagatgctctatccggccaatcaccgg
gtcctcgcctttctccggcgccacgaagacgaggtgatcctcgtagtgggaaacctctcc
cgcttcgcccaggccgtgagcctcgacctgaaggagttcgccggcatatcgccagcagac
ctcttcagccggaaccggtttccggtcatccgcgaaatcccctaccccctcaccctgggc
ccccacgatcatttctggttcatcctgagccgtgcagagtcgccacgcctgccagaggga
gaactgccgcggatcaacctcccgggaggactcccgtggtgggaggccctccagcatacc
ggaggggacacccgcctggaacgggcgaccaccgactacctgaaccgaagcggctggttc
cgggggaaagcccgggcaatcatcggctatgccctgcgcgacaccgtgcttctgcggaca
tcagaccaggtctttcccctgttcttcctggaggtccgctaccagaacggcgcgccggaa
acctacctgatccccgttgcgtttctccggggccccggggcgaaacgggtcgatgccgaa
tcgccacaggcggccattgcatccctctccgtgggggacgaagcagggatcctctgcgat
gcgctccatgaccgggagttcagggacgcgctcctcgcccttgcccttggccggcgccga
ctccatggtaaacgggagagcctcgtcgtaccgctccatgggagaggaggccacgccgaa
ggaatgcgggaaacggagcatctcatttccgagctcgtcacgggggaagaggcgagcagt
gtcatcctctatggcgatcggcacgtgttcaagctgtaccgcacggtggaaccgggggtg
aattcggaggtggagctggtccggtttctgacggaaaagtcccgctaccccaacattgtc
cccttccaggcgagtctcgagttgcgccatcccggcaccgaaccatgcaccattggcctt
gtgcaggaatatgtgaaaaaccagggtaacggctggcggctcgcgctccacctcctcggc
cagtacttcgagcggattctctcccgccggggcgagatccctcctccgccgaagcggttc
tcgagcctcatagacggcagcgcctgcaccgttccggaaccggtcgcgaatctcattggc
ggcttctatctggaaatggcgggacttctcgggcgtagaaccgccgaactccacctggcc
cttgccgcggggggaaacgatccggcctggaaaccggaggcgtattcaaccatttaccag
cgctccgtgtaccagtccatgcgcaaccaggcacggcgcacccttcagctcctgtcccag
aaccgcaatcttctgccgatcgacgaccagggaccggctgaccgggtcctgggggccgaa
aaggagattctctcctggctggcccaaatcgtcggccggcggatagggacgatgaagatc
cgcatccacggcaattttcacctggggaaagtgctcttcaccggcaaggatttcgtaatc
ctcgacttcgagggggagccggaccggaccctcagcgagcgccgcatcaagcgctctccc
ctgagggacgtggcatcaatgatccgctccttccacgctgccacgctgactgccctcgca
cggcatgggaacggccgttccggagacgtccagcttctggagccgtgggcggatgcctgc
tattaccacgtgagctgccgctacctcgcggggtacctcgaacggatggggaacagtccc
ctcgttccggcagaccggaacgacctggcgaccctcctccgctcgttcctgctcgacagg
gcgctccgcgacctcgggttcgccctgggcaaccgccccgaaacggcctcgtcccccctg
aaggggatcgagacggtgctgcgggaatacggggaatag

DBGET integrated database retrieval system