KEGG   Gemella morbillorum: NCTC11323_01402Help
Entry
NCTC11323_01402   CDS       T05494                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gmo  Gemella morbillorum
Pathway
gmo00010  Glycolysis / Gluconeogenesis
gmo00020  Citrate cycle (TCA cycle)
gmo00620  Pyruvate metabolism
gmo01100  Metabolic pathways
gmo01110  Biosynthesis of secondary metabolites
gmo01120  Microbial metabolism in diverse environments
gmo01130  Biosynthesis of antibiotics
gmo01200  Carbon metabolism
Module
gmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCTC11323_01402 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NCTC11323_01402 (pdhC)
   00620 Pyruvate metabolism
    NCTC11323_01402 (pdhC)
Enzymes [BR:gmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NCTC11323_01402 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: SQH55918
UniProt: A0A2X4ND26
LinkDB All DBs
Position
1:complement(1414030..1415418)
Genome map
AA seq 462 aa AA seqDB search
MAVEVIMPKAGSEMEEGEIVQWFKNEGDHVEAGEVLLEIVTDKVNMEVEADASGTLLKIL
AQAGDVVPVVKTIAWIGEPGEAIPGASETGEVAPAETIVEKKVDYTPVKEVEVVDYSGIR
ATPAARAYARKKGIDLSKVQGTGSKGRIHKDDVLEYKLNSKVKISPLAARIAQMEGINAE
SIVGTGPNGKVMKADILSVLNGAPKAAPAKKEEIAAPSKKSVKEPNENQWGVVETVPMSP
MRKVISKRMSESYFSAPTFVVNVEVDMTELLALRKKVVDAIIEETGKKATVTDFISLAVI
KSLMKHPYVNASLSSDEKEMYLHHYVNLSIAVGMDSGLVVPVIKGADKMSLKELVVASKE
ITTKALAGKLKPDEMADSTFTISNLGMYGVKSFVPIINQPNTAILGVSATVQKPVVLNGE
ITVRPIMTLTLTADHRVVDGLEGAKFMKTLKEAIENPLSLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaggttataatgccaaaagccggtagtgaaatggaagagggcgaaatcgta
caatggtttaaaaatgaaggagaccatgtcgaagcaggagaagtccttttagagattgta
acagacaaagtaaatatggaagttgaagctgatgctagcggaacattattaaaaatttta
gctcaagcaggagatgttgtaccagttgttaaaacaattgcttggataggtgaaccaggt
gaagctattccaggtgctagcgaaacaggagaagttgcgccagctgaaacaatagttgag
aaaaaagttgactacacacctgtaaaagaagttgaagtggtagactattctggtattcgt
gcaacaccagctgcaagagcatatgcgcgtaaaaaaggaattgatttatctaaagttcaa
ggaacaggatctaaaggtcgtatccataaagatgatgtattagaatataaacttaactct
aaagttaaaatttcaccacttgcagcacgtatagcgcaaatggaaggaattaatgctgag
agtatagtaggaacaggacctaatggtaaggttatgaaagctgatattctttcagtactt
aatggagctccaaaagcagctccagctaagaaagaagaaattgcagctcctagcaaaaaa
tctgttaaagagccaaacgaaaatcaatggggtgttgttgaaacagtaccaatgtcacca
atgcgtaaagttatttctaaacgtatgagtgaatcttactttagtgcaccaacgtttgtt
gttaatgtagaagttgatatgactgaactattagcattacgtaaaaaagttgttgatgca
attatcgaagaaactggtaaaaaagcaacagttacagacttcatttcattagcagtaatt
aaatcattaatgaaacacccatatgtgaatgcttcattatcaagtgatgaaaaagaaatg
tatctacaccactacgttaacttatcaattgcagtaggtatggatagtgggttagtagta
ccagtaattaaaggtgctgataagatgagtctaaaagagcttgtagtagcttctaaagaa
attacaacaaaagctcttgctggtaaattaaaaccagatgaaatggcagattcaacattt
acaatcagtaacttaggtatgtatggagttaagagcttcgtgccgattatcaaccaacct
aacacagcaattttaggagtaagtgctacagttcaaaaacctgtagtattaaatggtgaa
atcactgtaagacctattatgacattaacattaacagcagatcaccgtgtagttgacgga
ttagaaggagctaaattcatgaagactctgaaagaagctatcgaaaatccactatcatta
ctaatctaa

DBGET integrated database retrieval system