KEGG   Gimesia maris: GmarT_53820Help
Entry
GmarT_53820       CDS       T06180                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
gmr  Gimesia maris
Brite
KEGG Orthology (KO) [BR:gmr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    GmarT_53820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: QEG19482
UniProt: A0A5B9P2Q1
LinkDB All DBs
Position
6994842..6995819
Genome map
AA seq 325 aa AA seqDB search
MRFHRLRNVLKRSGSDFLSDECMGSGAAIAYYTIFSLPPLLAIVFAVTTQFWSAEKVSTV
INSQLGLPIEQSVSQADNDSSASALNLTRVAERAQPGHQQEHPWWARILGIGILIFSASG
VLAQLQGALNKAWNVEPDPRQGGLMSFLKKRLISLGMLVVIGLLLLVSLVLTTFVDEFTR
WIQNGELTGGMLTLMMLINGILTLGLAILLFAATFKVLPDAHIPWRDVFVGAGVTAFLFV
IGKAGIGWYLQYSEAGSSWGSAATSMIGILIWVYYSSLIILLGAEFTQNWSIEFGSGLKP
APGAILVTEEKNYHRTESEVLLHKN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagatttcatcgcctgcgaaacgtattaaaacgttccggatcagactttctgtccgac
gaatgcatgggcagcggtgcggcgatcgcatattacacgattttttcacttcccccgtta
ctcgcgatcgtgtttgctgtaacgacccagttctggtcagccgaaaaagtgagcacggtg
atcaattcccagctgggtttgcccatcgaacaaagcgtttctcaagcggacaacgattcg
tcagcttccgcattgaacctgacgcgtgtggctgagcgggcacaaccaggacatcaacag
gaacatccctggtgggcgcgaatcctgggaatcggaatcctgattttttctgccagtggt
gtcctggcccagttgcagggcgcgctaaataaagcctggaatgtcgaacccgatcccaga
cagggcggactgatgtcctttctcaaaaaaagattgatctccctggggatgctggtcgtt
atcgggctgctgttactcgtttccctggtactgacgacgtttgtcgatgagttcacgcgc
tggattcagaatggcgaactgaccgggggcatgctcacattgatgatgctcatcaatggc
atcttgactttagggctggcgatcttattatttgctgccaccttcaaggttctgcctgat
gcacacatcccatggcgcgatgtctttgtcggtgcaggcgtgacagcgtttctgtttgtg
attggaaaagccgggatcggctggtatctgcagtattcggaagcaggatccagctgggga
agcgcggcgacatcgatgattggaattctgatctgggtttactattcatccctcatcatt
ttactgggcgccgagttcacacaaaactggtcaattgaattcggcagcggtcttaaaccg
gctccgggcgcgattctcgtcactgaagaaaaaaactaccaccgtacagaaagtgaagtt
ctgcttcacaaaaattga

DBGET integrated database retrieval system