KEGG   Glycine max (soybean): 100499991Help
Entry
100499991         CDS       T01710                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100499991 (SOD1)
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100499991 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu GRDA
Motif
Other DBs
NCBI-GeneID: 100499991
NCBI-ProteinID: NP_001235298
UniProt: Q7M1R5 C6SZ56
LinkDB All DBs
Position
19
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVTGTIFFTQEGNGPTTVTGSLAGLKPGLHGFHVHALGDTTNGCLSTG
AHFNPNNNEHGAPEDENRHAGDLGNVNVGDDGTVSFSITDSQIPLTGPNSIIGRAVVVHA
DSDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttggcagcagcgagggtgtcactggaactattttcttc
actcaggagggaaatggtccaaccaccgtaactggatctcttgctggtcttaagcctggt
ctccatggcttccatgtccatgccttgggggacactaccaatggttgcctgtcaactgga
gcgcatttcaatcctaataacaacgagcacggtgcccctgaggacgagaatcgtcatgct
ggtgatcttgggaatgttaatgtcggtgatgatggtaccgttagcttcagtattaccgac
agtcagattcctctcactggaccaaactccatcataggaagggctgttgttgtccatgct
gattctgatgaccttggaaaaggtggtcatgagcttagcaaaactactggaaatgctggt
ggcagagtagcttgtggtatcattggtctgcaaggataa

DBGET integrated database retrieval system