KEGG   Glycine max (soybean): 100777498Help
Entry
100777498         CDS       T01710                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00052  Galactose metabolism
gmx00500  Starch and sucrose metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100777498
   00500 Starch and sucrose metabolism
    100777498
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100777498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100777498
NCBI-ProteinID: XP_003546284
LinkDB All DBs
Position
15
AA seq 907 aa AA seqDB search
MATRWRVTKATATIFSVFLIFCSSFSSLEATPVGYGYTISTVYNFPITNSLTANLDLIKP
SSVFGPDIPHLSLTASFENKDRLRVRITDSNHQRWEIPQEVIPRGSSFQYYPLRSLNSKQ
GSPQKKHSFSLTHPNSDLVFTLHNTTPFGFTVSRKSSNDVLFNTAPNPSNPETFLIFKDQ
YLQLSSSLPSQRASLFGLGEHTKSSFKLRPNQTLTLWTADIASANLDLNLYGSHPFYLDV
RSSSFDGKVKAGTTHGVLLFNSNGMDIMYGGDQITYKVIGGVFDFYFFVGSTPELVLEQY
TEFIGRPAPMPYWSFGFHQCRYGYKNVSDLQDVVANYAKASIPLEVMWTDIDYMDAYKDF
TFDPINFPLDKMRSFVDTLHKNGQKYVLIVDPGISVNETYATYIRGLQADVYIKRNGSNY
LGKVWPGPVYYPDFLNPRSQAFWGREIKLFRDLLPIDGLWIDMNELSNFITSPPIPFSNL
DNPPYKINNVGDQHSINDRTVPATSLHFGNITEYNVHNLYGLLESKVTNKALKDITGKRP
FILSRSTFVSSGKYAAHWTGDNAATWNDLAYSIPAILNSGIFGIPMVGADICGFGGNTTE
ELCRRWIQLGAFYPFARDHSDKNSNRQELYLWDSVADSAKKVLGLRYRLLPYLYTLMYEA
HTKGTPIARPLFFSFPEDVTTYEISSQFLLGKGVLVSPVLQSGATSVVAYFPKGSWFDLF
NVSNSVNAESGKYVTLDAPSDHINVHVGEGNILALQGEAITTVAARKTAFQLVVVISNSG
SSFGQVYLDDGEALDIAGVNDQWTLASFYGALHNNSVLVTSKVTNARFALDQRWIIDNVS
FLGIPKNKRFNGMDLAGNELKIVNGMDSMRTAVVKSEFDSSSQFVNVQVSKLSLPIGEEF
KLEIEIK
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggccacacgatggagagtgactaaagccaccgctactatcttcagtgtttttctcatc
ttttgctcctccttttcatcgttggaagcaacaccagttggttatggctacacaatctca
actgtttacaattttcccataaccaactctttaactgcaaaccttgatctcatcaaaccc
tcctctgttttcggacccgacattccacacctctccctcactgccagttttgagaacaag
gataggttgagagtgagaatcaccgactccaatcaccaaagatgggaaattccacaagaa
gtcattcccagaggctcctctttccagtattaccctcttcgctccctcaatagtaaacaa
ggttcccctcagaaaaaacactctttcagtctcacacatccaaattcagaccttgttttc
actctccacaacactaccccatttggcttcacagtctcgcgcaaatcctccaacgatgtc
ctcttcaacacggcacctaacccttccaaccccgaaacttttcttatttttaaggatcaa
tacctgcagctctcttcctctcttccatcacaaagagcctctctattcggcctcggggaa
cacaccaagagctccttcaagctgcgaccgaaccagacccttacactgtggactgcagac
attgcaagtgccaacttggacttgaacctttatggctctcaccctttttacttggacgtg
agatcatcctcttttgatggaaaagtgaaggctggcaccacacacggggtgttgttattc
aacagcaatggaatggacattatgtatggcggtgatcaaattacatataaggtcattggt
ggggtttttgatttctactttttcgttggatcaactcctgaactggtgttggagcaatac
actgaattcattggcaggcctgctcccatgccttattggtcctttggttttcatcagtgt
cgatatggctacaagaatgtaagtgatctccaggatgtggttgccaactatgcaaaagca
agtataccccttgaagttatgtggacagatatcgattacatggatgcatataaagatttc
acatttgatccaatcaactttccgctggataagatgagaagttttgttgatactcttcac
aagaatggtcagaaatatgtgcttatcgtggatccaggtatcagtgtaaatgagacatat
gcaacctatattagaggtttgcaggctgatgtctacataaagaggaatggaagcaactat
cttggtaaagtttggcctggaccagtttattatcctgattttctaaaccctcgcagccaa
gcattttggggccgggaaatcaaattatttagggacctgctccctattgatggtctttgg
attgacatgaatgagttatctaatttcattacttctcctcccattccattttctaatctt
gataatcctccctataaaattaacaatgttggagatcaacattccattaatgacagaaca
gttccagcaacatctttacactttggtaatatcactgagtataatgtccacaatttatat
ggactactagaatccaaagtaactaacaaagccttaaaggatataactggcaaaaggcca
ttcatcctaagtagatcaacttttgtgagttctggtaagtatgctgcccactggacagga
gacaatgctgctacatggaatgatttggcatactcaatccctgcgatattaaattctgga
atctttggaattccaatggttggagcagatatatgtggtttcggaggaaatacaactgaa
gaactttgccggcgctggatccagttgggggctttttaccccttcgcaagagatcattca
gacaagaactccaataggcaagagctttatctttgggactccgttgcagattcagctaag
aaagtgcttggcctccgttatcgtcttctcccttatttgtacacactgatgtatgaagca
cacacaaaagggacaccaattgcacgaccccttttcttttctttccctgaggatgtcaca
acttacgaaataagctcacaatttctattaggtaaaggggttctggtgtcacctgtgcta
caatctggggcaacctctgttgttgcatactttcctaaaggaagctggtttgacctcttt
aatgtctcaaattcagtgaatgcagaatcaggcaagtatgttactcttgatgctccatct
gatcacataaatgtgcatgttggggaaggtaatattttagctttgcaaggtgaagcaata
acaactgttgctgcccggaaaactgcatttcaacttgtggtagttatcagtaacagcgga
agtagttttggacaagtgtatttggatgatggggaggcacttgacatagcaggggtgaat
gatcagtggacattggcaagcttttatggcgcattacacaacaacagtgttttagtaaca
tctaaggtcactaatgcaagatttgctctggaccaaaggtggatcatagacaatgtaagt
ttcttggggatacctaagaataagagatttaatggaatggatttggcaggaaatgagttg
aaaattgtgaatggcatggattcaatgaggacggcagttgtgaagtcagaatttgatagc
tcttctcaatttgttaatgtacaagtttcaaaattgtcacttcctattggagaggaattc
aagctggagatagaaatcaagtag

DBGET integrated database retrieval system