Glycine max (soybean): 100778454 Help Entry 100778454         CDS       T01710                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism gmx  Glycine max (soybean) Pathway gmx04016   MAPK signaling pathway - plant gmx04070   Phosphatidylinositol signaling system gmx04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:gmx00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100778454    04070 Phosphatidylinositol signaling system     100778454  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100778454  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gmx01009]     100778454   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100778454    03036 Chromosome and associated proteins [BR:gmx03036]     100778454   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100778454 Protein phosphatases and associated proteins [BR:gmx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100778454 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100778454 Chromosome and associated proteins [BR:gmx03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100778454 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100778454 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EF-hand_4 DUF5580_M EF-hand_11 Dockerin_1 SurA_N_3 PTS_2-RNA SurA_N_2 Caleosin YqeY Motif Other DBs NCBI-GeneID:  100778454 NCBI-ProteinID:  XP_040862797 LinkDB All DBs Position 2:15260104..15261429 Genome browser AA seq 149 aa AA seqDB search MANAWTEDQIAIFHEAFDVVDKDSDGFISVDELLSIVRSLEGNSTKEEIREMISEVDIDG NGRSVNFENFLKIMGRTMKENQTEELKDSFKVFDRDNDGYISATELRQVMVKLGERLTDE EVEQMIREADLDGDGRVSYEEFVRFMTLN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgcatggacagaagatcaaatagctatattccatgaagcgtttgacgttgtt gacaaggactccgacggtttcatttcggtggacgaactcttatccattgtgcgatcatta gaaggaaactcaacaaaagaagaaattcgagaaatgattagtgaagttgacattgatgga aatggccggagtgtaaattttgaaaacttcttgaaaattatgggaaggacaatgaaggaa aatcagactgaggagctaaaagactcgttcaaagtattcgacagggataatgatggatat atatcagcaactgagctgagacaagtaatggtgaaattgggagagaggctaacagacgaa gaagttgaacaaatgattagagaagctgatttggatggagatggtcgagttagctatgaa gaatttgtgaggtttatgacgttaaattga

DBGET integrated database retrieval system