KEGG   Glycine max (soybean): 100781934Help
Entry
100781934         CDS       T01710                                 

Definition
(RefSeq) amino acid permease 8
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans DUF2484
Motif
Other DBs
NCBI-GeneID: 100781934
NCBI-ProteinID: XP_006581461
UniProt: A0A0R4J3H8
LinkDB All DBs
Position
6
AA seq 471 aa AA seqDB search
MDIEAGKDIPVRDPALLDDDGRIKRTGNVFTATTHIVTVVVGAGVLALAWAMAQLGWIAG
IAVMILFACISVYTYNLVADCYRFPDPVSGKRNYTYMQAVDAYLGGKMHVFCGSVLYGKL
AGVTVGYTITSSVSLVAIKKAICFHKKGHDAYCKFSNNPYMIGFGICQILLSQIPNFHKL
TWLSTIAAATSFGYAFIGSGLSLSVVVSGKGEATSIFGSKVGPDLSEADKVWKVFSALGN
IALACSFATVIYDIMDTLKSYPPENKQMKKANMLGITTMTILFLLCGGLGYAAFGDDTPG
NILTGFGFYEPFWLVALGNVFIVVHMVGAYQVMAQPLFRVIEMGANMAWPRSDFINKSYP
IKMGSLTCNINLFRIIWRSMYVAVATVIAMAMPFFNEFLALLGAIGFWPLIVFFPVQMHI
AQKRVKRLSLKWCCLQILSFACFLVTVSAAVGSVRGISKNIKKYKLFQYKQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattgaagcaggtaaagatattcctgtaagagacccagcgctactcgatgacgac
ggcagaatcaaaagaaccgggaacgtgttcactgctaccacgcacatagtaacggtggtg
gtgggtgcaggagtgctggctctggcatgggccatggctcagcttggatggatagctggc
atagccgttatgatcctctttgcatgcatttctgtttacacttacaatcttgtagctgat
tgctacagatttcctgacccagtcagtggcaagagaaactacacttacatgcaggccgtt
gatgcctaccttggtggaaaaatgcacgtgttctgcggatccgtcctatatgggaagctc
gccggggttacagtgggctacactataactagttctgtgagcttggtggctataaagaaa
gctatttgctttcacaaaaaaggccatgatgcttattgcaagttttcaaacaatccctat
atgattggttttgggatttgccaaattttattgtctcaaatcccaaatttccacaagtta
acgtggctttcaaccattgctgctgctacctctttcggttatgcattcattggaagcggg
ctttctctttcggtggtggtctcaggtaaaggagaagcaaccagtatatttggaagcaaa
gtaggaccagatttatctgaagcggataaagtttggaaggttttcagtgctttgggaaac
attgcacttgcttgctcatttgctactgttatttatgacataatggatacattgaagtcc
tatccaccagaaaacaaacagatgaaaaaggccaatatgttaggaatcacaacaatgaca
atacttttcctgctatgcggtggccttggctatgctgctttcggagatgacacgccgggg
aacatcctcaccggctttggattttacgagccattctggttggtcgcccttggcaatgtt
ttcattgtagtccacatggttggagcatatcaggtgatggctcaaccactatttcgtgta
attgagatgggtgctaacatggcgtggccgcgttcagatttcattaacaagagctatccc
atcaaaatgggctccttaacatgtaacatcaacttgtttaggataatttggaggtcaatg
tatgtggcagtggccacagttattgccatggctatgccatttttcaatgagtttcttgcc
ttgcttggagcaatagggttttggcctctcattgtcttcttccctgtacaaatgcacatt
gcacagaaacgggtaaaaagactatcattgaagtggtgttgtcttcaaatattgagcttc
gcgtgcttcctagttacagtttccgcggcagttggttcggttcgtggaattagcaagaat
ataaaaaaatacaaacttttccagtataaacaatag

DBGET integrated database retrieval system