KEGG   Glycine max (soybean): 100782330Help
Entry
100782330         CDS       T01710                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00250  Alanine, aspartate and glutamate metabolism
gmx00410  beta-Alanine metabolism
gmx00430  Taurine and hypotaurine metabolism
gmx00650  Butanoate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Module
gmx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100782330
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100782330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100782330
   00430 Taurine and hypotaurine metabolism
    100782330
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100782330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 100782330
NCBI-ProteinID: XP_003531123
UniProt: I1KRN4
LinkDB All DBs
Position
8
AA seq 493 aa AA seqDB search
MVFPKPSSESDLFLCSNFASRYARDSLPRFSMPENSMPKEAAYQNIHDELQLDAIPKLNL
ASFVTTSMEEECNKLIMESINKNYVDMDEYPATTDLHNRCVNMIARMFHAEIGENENATG
AGTVGSSEAIMLAGLAFKKKWQNKRKAEGKPYDKPNLVTGSNVQVCWEKFARYFEVELRE
VEVREGYYVMDPAKAVELVDENTICVAAILGSTYNGEFEDVKLLNDLLLEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKDDLPEDL
VFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGHEGYRSIMENCRDNAMVLKESLEK
SGHFNILSKDNGVPVVAFSLKDRSQYDEYKISEMLRRHGWIVPAYPMPPAAQHINVLRVV
IRAEFSRTLAERLVFDIYNVLHELEKLHPPKVTNFIKEENKALVETGVKKTALDAHREII
AQESNKRQKIMAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtttttccaaaaccctcttctgagtctgacctctttctttgttccaactttgcttct
cgctatgccagggactctcttcccaggttcagcatgccagagaactccatgcctaaggag
gctgcgtaccaaaacattcacgatgagttgcagcttgatgcaattccaaagctgaacttg
gcttcttttgtgaccacttccatggaagaagagtgcaacaaactcatcatggaatccatc
aacaagaactatgttgacatggacgagtatcctgccaccactgaccttcacaatcgatgt
gtgaacatgatagcacgtatgttccatgctgagatcggagaaaatgagaatgcaactgga
gcaggaacagttggatcatcagaggccataatgctggcagggcttgcattcaagaagaag
tggcagaacaagcgcaaggcagagggaaagccttatgataagccaaatttggtgactggt
tccaatgtgcaagtatgttgggagaaatttgcaaggtattttgaggtggagttgagggaa
gtggaggtcagagaaggctattatgtcatggaccctgccaaagccgttgaacttgttgat
gagaacactatttgtgtggctgcaatcttgggttcaacttacaatggagagttcgaagat
gtcaagcttttaaatgacctgttgctagaaaaaaacaagcaaactggatgggatacgcct
attcacgtggatgctgcaagtggtgggtttattgctccattcctatatccagagctagaa
tgggatttcagactcccattggtgaagagcataaatgttagtggccacaagtatgggctt
gtttatgctggcattggttgggttatttggaggaccaaggatgacttgccagaagacctt
gtcttccatattaactaccttggagctgaccaacccaccttcaccctcaatttctctaaa
ggttctagtcagatcattgctcaatattatcagctaattcgccttggccatgagggatac
cgtagcataatggagaactgcagagacaatgcaatggtgctgaaggaaagtttggagaag
agtggacactttaacatactctcaaaagacaatggtgttcctgttgtggcattttctcta
aaggacagaagccagtacgatgagtacaagatatcagagatgttgcgtcgccacggttgg
attgtgccggcatatccaatgccaccagctgctcaacacatcaatgtgctccgtgtggtc
atcagggctgagttttcacgcacccttgctgaacgccttgtgtttgacatatacaatgtg
ctgcatgaacttgaaaagctacatccccccaaagtgaccaacttcattaaggaagaaaac
aaggccttggttgaaactggtgtcaagaaaactgcattggatgcacatagggaaatcatt
gctcaagaatcaaacaagcgtcagaaaattatggctgcctaa

DBGET integrated database retrieval system