KEGG   Glycine max (soybean): 100783155Help
Entry
100783155         CDS       T01710                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gmx  Glycine max (soybean)
Pathway
gmx03030  DNA replication
gmx03410  Base excision repair
gmx03420  Nucleotide excision repair
gmx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100783155
   03410 Base excision repair
    100783155
   03420 Nucleotide excision repair
    100783155
   03430 Mismatch repair
    100783155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gmx03032]
    100783155
   03400 DNA repair and recombination proteins [BR:gmx03400]
    100783155
Enzymes [BR:gmx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100783155
    6.5.1.6  DNA ligase (ATP or NAD+)
     100783155
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100783155
DNA replication proteins [BR:gmx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100783155
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100783155
DNA repair and recombination proteins [BR:gmx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100783155
   NER (nucleotide excision repair)
    Other NER factors
     100783155
   MMR (mismatch excision repair)
    Other MMR factors
     100783155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 100783155
NCBI-ProteinID: XP_003539790
UniProt: I1LR88
LinkDB All DBs
Position
12
AA seq 776 aa AA seqDB search
MLALHFRPCFPLPFHRSLTVRVSSLLSFPLSLSSAVPLRAMSKPPSAFDALMSGARAAAA
AKKKSQSLSQSSPSSPKKRKTPPSSSSQNPSDLKPPSPPKTVTPQEGAVKPEPLKVRHVS
SSSFSQEKTAELKKQAPQLKKKPSDFDPASISAWEKGQPVPFLFLCLAFDMISQESGRIV
ITDIVCNLLRTVMYSTPEDLVKVVYLSANRIAPAHEGMELGIGDASIVKALAEAYGRTEV
WIKTQYQKKGDLGLVAKESRSSQPMMFKPEALTITKVFNTFRLIAKESGKESQEKKKNHI
KALLVAATDCEPQYLIRLLQTKLRIGYAEKTLLAALGQAAVYTEEHSKPPPDIQSPLEEA
SEIVKQVYSVLPDYDKIISALLTEGLWMLPKKCNFTPGVPIGPMLSKATKGVSEILNKFQ
DVEFTCEYKYDGERAQIHYLENGSVEIYSRNAERNTGKFPDVVAAVSRLKKPTVSSFILD
CEIVAYDRSTQKIRSFQMLSTRARKNVEIEDITVGVCIFAFDLLYLNGQALLQENLRVRR
EHLYASFEEEPGFLQFATTITSNDVEEIQNFLDQAVGASCEGLIIKTLNEDATYEPSKRS
LNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDNDNEEFQSICKIGTG
FSEAVLEERSSSLRSKVIPKPKAYYRFGETINPDVWFEASEVWEVKAADLTISPVHRAAV
GIVDPNKGISLRFPRLLRVRPDKAPEQASSSEQVAEMYKAQKHNHTNNQNDDEDDD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcattgcattttcgcccttgctttcctcttcccttccatcgctccctaacagtt
agggtttcctctctcctctcttttcctctttctctctcctccgccgtccctctccgcgcc
atgtcgaagcccccctccgccttcgatgccctcatgtccggcgcacgcgccgccgccgcc
gccaagaaaaaatcccaatccctttcccaatcatcaccctcatcccccaagaaacgcaaa
accccaccctcctcttcctcacaaaaccctagcgacctcaaacctccttccccacccaaa
accgttacacctcaagaaggcgccgttaagcccgaaccgctgaaggtccgccacgtgtca
tcttcttctttttcgcaggagaagaccgcggagcttaagaagcaagctccgcagctgaag
aagaaaccctccgatttcgatcccgcttctataagtgcatgggagaagggccaacccgtg
ccgtttctatttctctgcttggccttcgacatgatttctcaagaatccggaagaattgtc
atcactgatattgtttgcaatcttctgaggactgtgatgtactccacgccggaggatctt
gttaaggtcgtttacctctccgcgaaccggattgcgcccgctcacgaagggatggaattg
ggtattggcgacgcttccatcgtcaaggcgcttgctgaggcgtacggaaggaccgaggtg
tggattaagactcagtatcagaaaaaaggggatttgggcttggttgctaaagagagccgt
tcctcgcagcctatgatgtttaagcccgaagcattgactattacgaaggttttcaacact
tttcgtcttattgctaaggaatctgggaaagaaagtcaagagaagaaaaagaatcatatc
aaggcacttcttgttgctgcaactgactgtgaacctcaatatctaatccgtttgctacag
acaaagttgcgaattggctatgctgagaaaactctcttagctgcattgggccaagctgca
gtatacactgaagaacactctaaaccgcctcctgatattcagtctcctttagaagaggct
tcagagattgttaaacaagtctattctgtacttcctgactatgacaaaataatatctgca
ctgcttacagagggtctatggatgcttccaaagaaatgtaattttactcctggtgttcca
attggacctatgctatcaaaggcaacaaagggtgtatctgaaattctaaataaattccag
gatgtggagtttacctgtgaatacaaatatgacggagagcgtgcccagatacattacctg
gagaatggatcagttgagatttacagtagaaatgcagaacggaatactgggaagtttcct
gatgttgttgccgctgtttcaaggttaaagaaaccaactgtatcatcatttattcttgat
tgtgaaattgttgcatatgatcgttcaacacagaagatccgttctttccagatgcttagt
actcgggctcgcaagaatgtagaaattgaagatataacggttggtgtttgcatatttgct
tttgatttgttgtatcttaatggccaagcacttcttcaggaaaacctgagagtccgtaga
gagcatctctatgcctcttttgaggaagaacccggatttcttcagtttgcaacaacaata
acatcaaatgatgttgaggaaatacagaattttcttgaccaagctgttggtgctagttgt
gagggattaattattaaaacattaaatgaggatgctacatatgaaccttccaagcgatca
ctcaactggctaaaactgaagaaagattatatggacagtataggggactcactagatttg
gtacctattgctgctttccacggtcgtgggaaacgtacaggagtttatggtgccttcctc
cttgcttgctatgacaatgataatgaagaatttcaaagtatttgcaagataggaacggga
ttctctgaagctgtgcttgaagaacgttcttctagtcttcgttctaaagtgattcccaaa
ccaaaggcatactatagatttggagaaacaataaatcctgatgtctggtttgaagccagt
gaggtgtgggaggtgaaagctgccgacctgaccattagccctgttcaccgtgctgcagtg
ggcatagtagatccgaacaagggcatatctctacgatttccacgactacttcgagtcagg
cctgacaaagctcctgaacaggcctcatcatctgagcaggttgctgaaatgtataaggct
caaaaacacaatcacacgaacaaccaaaatgacgatgaagatgatgattga

DBGET integrated database retrieval system