KEGG   Glycine max (soybean): 100786455Help
Entry
100786455         CDS       T01710                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00020  Citrate cycle (TCA cycle)
gmx00620  Pyruvate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
Module
gmx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100786455
   00020 Citrate cycle (TCA cycle)
    100786455
   00620 Pyruvate metabolism
    100786455
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100786455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 100786455
NCBI-ProteinID: XP_003536381
UniProt: I1LD65
LinkDB All DBs
Position
10
AA seq 469 aa AA seqDB search
MMAQLLHTPFIPSSSSALRRAATIPHRKTTSRLVVRAKIREIFMPALSSTMTEGKIVSWT
KSEGDKLSKGDSVVVVESDKADMDVETFYDGYLAAIVVEEGGVAAVGSPIAFLAETEDEI
PQAKSKASSSSSSSSAPAPAPAPAPAPAQAPPVESQPEKVAAPVAAAVSAPVIASSHPAS
EGGKRTVASPYAKKLAKELKVELGRIVGTGPMGRIVAKDVEAFAAAGNVAAAAPAPGKSA
APAGMELGSVVPFTTMQSAVSRNMLESLAVPTFRVGYTITTDALDALYKKIKSKGVTMTA
LLAKATALALVKHPVMNSSCRDGNSFTYNSSINIAVAVAIDGGLITPVLQGADKIDVYSL
SRKWKELVDKARAKQLQPHEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASEPTV
VATKDGRIGMKNQMQVNVTADHRVIYGADLASFLQTLTQIIEDPKDLTF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcagcttctccacactcccttcatcccttcctcctcctccgcgctccgccgc
gccgccaccattccccaccgcaaaacgacctctcgcctcgtcgttcgggccaagatccgg
gagattttcatgccggcactgagctccaccatgaccgagggcaaaatcgtctcctggacc
aaatccgaaggcgacaagctctccaagggcgacagcgtcgtcgtcgtcgagtccgacaag
gccgacatggacgtcgagaccttctacgacggctacctcgccgccatcgtcgtcgaggaa
ggcggcgtcgccgccgtcggatcccccatcgcattccttgccgagaccgaggacgagatt
cctcaagccaagtccaaagcctcttcttcttcctcttcctcttccgcacctgcaccagca
ccagcaccagcaccagcaccagcacaagcaccgccagtggaatctcaaccggaaaaggtt
gcggcgccagtcgcagctgcggtttcagctccggtcattgcgtccagtcatcctgcttcg
gagggagggaagaggactgttgcttcaccttatgcgaagaagcttgccaaggagttgaag
gtggagttggggaggattgtggggactggaccgatggggaggattgtggctaaagatgtt
gaggcatttgcggcggcaggtaatgttgcagcggcagcaccggcaccggggaagagtgca
gcacctgccgggatggagttgggatccgtggtgcctttcaccacaatgcagagtgctgtg
agtaggaacatgctggagagtttggcggttcccactttcagagttggttacaccatcacc
acggatgcactcgatgccttgtacaagaagatcaagtcaaagggagtcacaatgacagca
ttgcttgctaaggctactgcacttgcgctggttaaacaccctgttatgaactctagttgt
agagatggtaatagctttacatataatagcagcatcaatattgctgttgctgtggctata
gatggcggattgattacaccagtgcttcagggtgctgataagattgatgtctattcattg
tcaagaaagtggaaggagttggttgacaaggccagagcgaagcagcttcaacctcatgaa
tacaacactggtactttcactctgtccaatctgggaatgtttggtgttgatcgctttgat
gctattctgccacctggaactggagcaataatggctgttggagcatcggagcccactgtt
gtggctacaaaggatggtcgcattggaatgaagaaccaaatgcaggtcaatgttaccgct
gatcatcgagtaatctatggtgctgatttggcttcattcttgcaaaccctgacccagatt
attgaggaccccaaagatcttactttctag

DBGET integrated database retrieval system