KEGG   Glycine max (soybean): 100786773Help
Entry
100786773         CDS       T01710                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00053  Ascorbate and aldarate metabolism
gmx00071  Fatty acid degradation
gmx00280  Valine, leucine and isoleucine degradation
gmx00310  Lysine degradation
gmx00330  Arginine and proline metabolism
gmx00340  Histidine metabolism
gmx00380  Tryptophan metabolism
gmx00410  beta-Alanine metabolism
gmx00561  Glycerolipid metabolism
gmx00620  Pyruvate metabolism
gmx00903  Limonene and pinene degradation
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100786773
   00053 Ascorbate and aldarate metabolism
    100786773
   00620 Pyruvate metabolism
    100786773
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100786773
   00561 Glycerolipid metabolism
    100786773
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100786773
   00310 Lysine degradation
    100786773
   00330 Arginine and proline metabolism
    100786773
   00340 Histidine metabolism
    100786773
   00380 Tryptophan metabolism
    100786773
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100786773
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    100786773
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100786773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100786773
NCBI-ProteinID: XP_003517756
UniProt: I1J5A5
LinkDB All DBs
Position
1
AA seq 538 aa AA seqDB search
MASSMRISRLLSRSFLSASTTPLFSRGGSGALGAGLSKFSTAAAIEEPIKPPVKVEHTQL
LIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDVDRAVAAARKAFDHGPWPKMTAYE
RQRILLRAADLFEKHNDELAALETWDNGKPYEQSAQIEIPMLVRLFRYYAGWADKIHGLT
VPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWKVGPALACGNTIVLKTAEQTPLSALY
ASKLLHEAGLPPGVLNVISGFGPTAGAAIASHMDIDKLAFTGSTETGKVVLELAARSNLK
PVTLELGGKSPFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAK
ARALKRAVGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQP
TVFSNVKDDMLIAKEEIFGPVQTILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLT
RALRVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcaatgaggatctcaaggctgctctctcgttcttttctttctgcttccact
actcctttgttctctagaggtggaagtggtgctcttggtgcagggctcagtaaattcagc
actgctgctgcaattgaagaaccaatcaaaccaccagttaaagtagaacacacccagctc
ttaatcgatggaaaattcgttgatgctgctactggcaaaacttttccaacgttggacccc
aggacaggagatgtgatttctcatgttgctgagggtgaccatgaagatgttgatcgagca
gttgcagctgctcgcaaagccttcgaccatggaccttggccaaagatgacagcctatgaa
agacaaaggatattgctgcgtgctgctgatctgtttgaaaagcacaatgatgagcttgct
gctcttgagacttgggataatgggaagccatatgaacaatctgctcaaatcgaaattcca
atgctggttcgcctatttcgatactatgctggttgggcagataagattcatggtctcaca
gttccagctgatgggccatatcatgtgcaaacattgcatgaacccattggtgttgctggt
cagatcattccgtggaacttccctcttgtcatgtttgcctggaaggttgggccagcattg
gcctgtggtaacaccattgttctcaaaacagctgagcagactccattatctgctttgtat
gcatcaaagttgcttcatgaggctggacttcctcctggcgttctgaatgtaatatctggc
tttggtcctaccgctggtgctgccattgctagtcacatggacatagataagcttgctttc
actggttcaaccgaaactggaaaagttgtccttgaattggcagctagaagtaatcttaag
cctgttactctggagcttggtgggaaatctccttttatagtatgcgaagatgctgatgta
gatgaggctgttgagctagcacactttgcattattctttaatcagggacaatgctgctgt
gctgggtctagaacatttgtacacgaacgtgtgtacgatgaatttattgagaaagcaaag
gcacgtgctttgaagcgtgctgttggtgatccattcaaggggggaatagagcaaggtcct
cagattgattcagaacaatttcagaaaatactgaagtatattaggtccggtgttgaaagt
ggagctactcttgaaactggaggagatagatttggcaactcaggcttctatattcagcct
actgtcttctcaaatgttaaggatgacatgctgattgcaaaggaagagatctttggtcca
gtgcaaaccatattaaaattcaaggaccttgatgatgtgattcaaagagcaaataacaca
cactatggccttgcagcaggggtgttcacaaaaaacattaacacagctaacactttgact
agagcattgcgagttggaacagtgtggattaactgctttgatacatttgatgcagcaatt
ccctttggagggtacaaaatgagtggccaaggaagagaaaaaggagaatacagtctcaag
aactacttgcaagtgaaggctgttgttacatccttgaagaaccctgcttggctttga

DBGET integrated database retrieval system