KEGG   Glycine max (soybean): 100787064Help
Entry
100787064         CDS       T01710                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gmx01001]
    100787064
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100787064
Protein kinases [BR:gmx01001]
 Serine/threonine kinases: STE group
  STE11 family
   100787064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100787064
NCBI-ProteinID: XP_003525123
UniProt: I1K4Z1
LinkDB All DBs
Position
5
AA seq 600 aa AA seqDB search
MPAWWNRKWSKSKEEDEEDEPRAGFHLNFMKSPVSVTSSKSKSKTTTPTPMKKKKKPKSF
DEKVEGVPLPRPAHSHADPLGSVSVSGGSSVSSSTSFDDHPISSPNTNPNPNRGHDEVRV
NVRSKSPGPGSRGPTSPTSPLHQRLNNLSLDSPTGSQCHPLPLPPGSPTSPSSVLSNARA
NAHLENATSNVSKWRKGKLLGRGTFGHVYLGFNSENGQMCAIKEVKVVSDDQTSKECLKQ
LNQEINLLNQLSHPNIVQYHGSELVEESLSVYLEYVSGGSIHKLLQEYGSFKEPVIQNYT
RQIVSGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHINSSASMLSFKGSPYWM
APEVVMNTNGYSLPVDIWSLGCTIIEMATSKPPWNQYEGVAAIFKIGNSKDMPEIPEHLS
NDAKNFIKLCLQRDPLARPTAHKLLDHPFIRDQSATKAANVSITRDAFPCMFDGSRTPPV
LESHSNRTSITSLDGDFASKPALAAPRALRSPRDNTRMITSLPVSPSSSPLRRYGPTHQS
CFFSPPHPAYTIMGQSSYTLNDISSYPMTSNATFALDPWHETSRYRANTPPGGSPRMRLI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttggtggaatagaaagtggagcaagagcaaggaggaggatgaggaggatgag
ccacgtgccggttttcacttgaattttatgaaatctccggtttctgttacatcgtctaag
agcaagagtaagaccacgacgccgacgccgatgaagaagaagaagaagcccaagagcttc
gacgagaaggtggagggtgttcccttgcctcgtccggcgcatagtcacgccgatcctctt
ggatctgtttcggtgtcggggggttccagcgtcagctcctccacctccttcgacgatcat
ccaatttcgtctcccaacaccaaccccaaccccaacagaggacatgatgaggttagggtc
aatgtaaggtcaaaaagtccgggtcctgggtcaagaggacctaccagtcctacctcaccg
cttcatcaaaggttgaataatttgagccttgactctcctacggggagtcagtgtcatcca
ttacctcttccacctggctctccaactagtccttcttctgtgctttccaacgcacgagca
aatgcacatttggaaaatgctactagcaatgtgtccaagtggagaaaaggaaagcttcta
ggacggggaacatttgggcatgtatatctgggattcaatagtgaaaatggacaaatgtgt
gcaataaaagaggtcaaggttgtctctgatgatcaaacatcaaaagagtgcctcaaacaa
cttaaccaggagataaatttgctaaatcagctttcacaccctaatattgttcaataccat
gggagtgaactggtagaagaatcactttctgtatatttggaatatgtctctggtggttct
atccataaattacttcaggagtatggttcatttaaggagcctgttattcaaaattatacc
agacagattgtctctggacttgcctatctgcatggaagaaatacagtacacagggatatt
aaaggggcgaacatactagttgatcctaatggtgaaatcaaactggcagactttggaatg
gctaaacatataaattcttctgcctcaatgctttcattcaaaggaagtccatactggatg
gcacctgaggttgtaatgaatacaaatggctatagtcttccagttgatatatggagcttg
ggatgcacaattattgaaatggcaacatcaaaacctccatggaatcagtatgaaggggta
gctgccatatttaaaattgggaacagcaaagatatgcctgaaatccccgagcatctttcg
aacgatgcaaaaaatttcatcaagctatgcttacaaagagacccattagctcgcccgaca
gcccataagttactagaccaccccttcattcgagatcaatcggcaacaaaagctgcaaat
gtcagcataaccagagatgcttttccttgcatgtttgatggaagccggacaccgcctgtg
ttagagtcccattccaaccgaacaagtataacttctcttgatggagattttgcatcaaag
ccagctcttgcagcaccacgagcattaaggagtcctagagataacacaagaatgatcaca
tctttaccagtatctccctcttcaagtccattgcgacggtatgggccaacgcatcagagc
tgttttttctctcctcctcatccagcttacacaataatgggacaaagtagttacactttg
aatgacatatcatcatatccaatgacatcaaatgccacgtttgctcttgatccttggcat
gaaacatctcgatacagagccaatacaccacctggtggatctccaagaatgagactcatt
tga

DBGET integrated database retrieval system