KEGG   Glycine max (soybean): 100791541Help
Entry
100791541         CDS       T01710                                 

Definition
(RefSeq) DNA gyrase subunit A, chloroplastic/mitochondrial
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gmx03032]
    100791541
   03400 DNA repair and recombination proteins [BR:gmx03400]
    100791541
Enzymes [BR:gmx01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     100791541
DNA replication proteins [BR:gmx03032]
 Prokaryotic type
  DNA Topoisomerases
   100791541
DNA repair and recombination proteins [BR:gmx03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      100791541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C Syntaxin-18_N
Motif
Other DBs
NCBI-GeneID: 100791541
NCBI-ProteinID: XP_006587249
UniProt: A0A368UHN9
LinkDB All DBs
Position
9
AA seq 935 aa AA seqDB search
MKPSSLHFQNPNPIFCSPMAHSALRVLRLSPFLQPLRLRHAPSELRFLSARAPRRPASAF
RSARRRDDENGSVTTAASATTDNGYVSEGRVVPTELHKEATEAYMAYAMSVLLGRALPDV
RDGLKPVHRRILFAMHELGLSSKKPFKKCARVVGEVLGKFHPHGDTAVYDSLVRMAQDFS
LRSPLIQGHGNFGSIDADPPAAMRYTECRLDDLTEAMLLTDLEQDTVDFVPNFDNSQKEP
SLLPARLPTLLLNGSSGIAVGMATNIPPHNLGEVVDVLCVLIHNPEATLQELLEYMPGPD
FPTGGLIMGNLGILEAYRTGRGRVIIRGKTDIELLDSKTKRTAIIIKEIPYQTNKATLVE
KIAELVENKSLDGISDIRDESDRSGMRIVIELKRGSDPLIVLNNLYRLTSLQSTFSCNMV
GILNGQPKQMGLKELLQAFLDFRCSVVERRARFKLSQAQERRHIVEGILIGFDNLDGVIR
IIREASSNSAAAAGLRNAFSLSEKQAEALLDISLRRLSLRESGNFVAESKSLMEQISKLE
ELLSSRKNILELIEQEAIELKSKFSNPRRSMLEDTDNGQLEDIDVIPNEEMILALSEKGY
MKRMKPSTFNLQNRGTIGKSVGKLKVNDSMSDFLVCHAHDHVLYFSDKGTVYSARAYKIP
ECSRTAAGTPLVQILSLSDGERITSIIPVSEFAEDQFLLMLTMQGYIKRVSLNLFSSIRS
IGIIAIQLVPGDELKWVRLCSNDDFVAMASHNGMVMLSQCSKIRTLSRNTRGAPAMRLKK
GDKMASVDIIPAAMWNNLETTSKFPGINAKSQNGPWLLFVSENGYGKRVPLSSFRISSLN
RVGLIGYKFSAEDRLAAVFVVGFSSAEDGESDEQVVLVSQSGTVNRIKVRDISIQSRFAR
GVILMRLDHSGKIQSASLISATDCEPEEVLAIAQG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccctcttccctccatttccaaaaccctaaccctatcttctgcagccccatggca
cactccgcgctccgcgtcctccgcctctcccccttcctccagccattgcgcctccgccac
gccccctccgagctccgcttcctctccgcccgcgcgccgcggcgcccggcctcggcgttt
cggtccgccaggcgccgcgacgacgagaatgggagcgtcacgacggcggcgtcggcgacg
acagataacggttacgtgagcgaggggagggtggtgccgacggagcttcacaaagaggcc
acagaggcttacatggcgtatgcaatgtccgttctgctcggtcgcgcgttgcccgatgtt
cgcgacgggttgaagcccgtgcaccgaaggattctatttgctatgcatgagcttggcctc
tcatccaaaaaaccgttcaagaagtgtgcgagagttgttggagaggtattgggaaaattc
caccctcatggagacactgctgtgtatgattccttggtgcgaatggcccaggatttttct
ttacgcagtcctttgattcaaggtcatggaaattttgggtcaattgatgctgaccctcct
gctgccatgcgttacacagagtgcagactggacgatctgactgaagcaatgttgttgaca
gatctagagcaggacacggttgattttgttccgaattttgataattctcaaaaagaacca
tcacttctaccagctcgccttccaaccttattgttaaatggttcttctggcattgcggtt
ggtatggcaactaatatccctcctcataatcttggggaagttgttgatgtgctctgtgtg
ttgatacataatcccgaagctactctgcaagaattgcttgaatacatgcctggaccagat
tttccaacaggagggctgattatgggaaatcttgggatcttagaggcataccgtactggc
cgaggacgtgttattattagaggaaaaaccgatattgaattgcttgattcaaagacaaaa
cggactgcaataatcataaaagagattccttaccagaccaacaaagcaactttagttgag
aagattgctgaacttgtagaaaacaagagtttagatgggataagtgatattcgggatgag
agtgatcgttctggaatgcgtatagttattgagctgaagcggggatcagatccattgatt
gttttaaataatctttatcgcttaacatctctgcaatcaacatttagctgtaatatggtg
ggcattctaaatggacaacctaaacaaatggggctgaaggaattactgcaggcattctta
gacttcagatgctctgttgttgagaggcgtgcaaggtttaagttatcacaagcacaagag
agaagacatattgttgagggtattcttattgggtttgataatctggatggagtgattcgc
ataatacgtgaagcttcaagtaactcggctgcagcagctggtttacgtaatgcattcagt
ctctctgagaaacaagctgaagctcttctggacattagcctaagaagactgtcccttcgt
gagagtggaaactttgtggctgaaagtaaatctttgatggaacaaatttccaagttagag
gaactgttgtccagcaggaaaaatatactggagcttatagaacaagaagcaattgaactg
aagagtaagttttccaatccaagacgttcaatgttggaggacacagataatggtcaactt
gaggacattgatgttattccaaatgaagagatgatattggcacttagtgaaaaaggttat
atgaaacggatgaagccaagcacttttaacctacaaaatcgtggaacaattggaaaatct
gtaggaaaattaaaagtgaacgattcaatgtctgattttctcgtttgtcatgcacacgat
catgtcctatatttcagtgataagggaacagtttactcagctcgtgcctacaaaattcct
gaatgtagccgcactgctgctggcacaccacttgttcagatcttatctttatctgatggt
gaaagaataacatctattattcctgtgagtgagtttgctgaggatcagtttttgctgatg
cttacaatgcaaggctatatcaagagagtatccttgaatttgttttcatcaatcaggtcg
atcggaatcattgctattcaattggttcctggtgatgagctgaaatgggtccgtctttgc
tcaaatgatgactttgtggccatggcttctcacaatggaatggtcatgctaagccaatgc
agcaagattcgcacactaagtagaaatacgcggggggcacctgcaatgagactcaaaaaa
ggggataagatggcgagtgtggacattataccagcagcgatgtggaacaacttggaaacc
acatcaaaatttcctgggatcaatgcaaagagccaaaatgggccatggttattgttcgta
tctgagaatggttatggaaagagagttcctttgagcagtttccggatatcatctttgaat
cgagttggtttgataggatataagttttctgctgaggatcgcttggctgctgtttttgtg
gtaggattctcatcagcagaggatggtgaaagtgatgaacaagtggttctcgtaagccaa
agtggcactgtcaacagaattaaggttcgggatatttcaatacaatcccgatttgcaagg
ggagttattttgatgcgacttgatcattccggaaagattcagtctgcttcattgatctca
gcaacagattgtgagcctgaggaagttcttgccattgctcaaggatag

DBGET integrated database retrieval system