KEGG   Glycine max (soybean): 100795451Help
Entry
100795451         CDS       T01710                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZA1-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100795451
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100795451
Chromosome and associated proteins [BR:gmx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100795451
   Polycomb group proteins
    PRC2-EZH2 complex
     100795451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR SLIDE
Motif
Other DBs
NCBI-GeneID: 100795451
NCBI-ProteinID: XP_003519745
UniProt: K7K5W6
LinkDB All DBs
Position
2
AA seq 868 aa AA seqDB search
MVSKPTDSASKPRKQLGEPANDGIGSLSLELNQLKKQIQAERIVCIKEKIRSNEKKLQCH
MSGVLSETSTRGSSQTEENRKNPILSSRIDHPLCKFSGFSPVWGDKDHNNQDVLSATSIK
MPYIETLPPYTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTEPEEEK
HEFSEAEDRVIWMAFEEYGLNKEVPNIVSEFVGGTSLEIQERYKTIKEKNIGRLDQPSQN
SGEYESTIGICLEKSLSAALDSFDNLFCRRCLIFDCRLHGCSQPLIYHSEKQTVWSDPEG
DRKPCSDQCYLQLKVVKNVTEDSTSGSDQNKRTTITEEADVILAPSIIEEPSNQSIIPFQ
TEVDCHGSLNLNVPISVSVEKRKVLNQSDMSPRDSTLHPNDCQNSYKKLKAISDAVVTVN
SDSSKKISLGACGESIHTITSAILDKSVKDNSIKLIDSSSTCPSDEQDKSIGDGPKDPTN
ETEFKMSNSMEGIVDGMLSLSDWKPLEKELYLKGVELFGRNSCLIARNLLPGLKTCMEIA
SYMHSGGVSMPHGSIVAPSSIMEEKGKFDADCTDQEMPSRSRLLRKRGKTRKFKYSWKSA
GHPSIWKRIADGKNQSCKQYTPCGCQSMCGKECTCINGGTCCEKYCGCSKSCKNRFRGCH
CAKSQCRSRQCPCFAAGRECDPDVCRNCWVSCGDGSLGEPPRRGEGQCGNMRLLLRQQQR
ILLAKSDVAGWGAFLKNPVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQY
VLDAYRKGDKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQA
PPWARKPEGSKRDESTAPQGRAKKHQSH
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccaaacctaccgactcggcttccaaacctcgaaaacaacttggagagccagca
aatgatggtattggaagcttgtccctcgagttaaatcagttaaaaaagcaaatccaggcg
gagagaattgtgtgcattaaagaaaaaattcggagcaatgagaagaagctacagtgtcat
atgtcaggagtcctgtcagaaacatcaacaaggggttcttcacagacagaggaaaatagg
aaaaatccaattctttcttcaagaattgaccatcctttatgtaaattcagtggtttctct
ccagtctggggagacaaggaccacaacaatcaagatgtattatctgctacaagtatcaaa
atgccttatattgaaacactaccaccatatacctcttggatatttctggacagaaatcag
aggatggcggaagatcagtcagtggttggaagaagacgcatatactatgatcaacatgga
agtgaagcactgatatgtagcgacagtgaggaggagttaacagaacctgaggaagaaaaa
catgaattttctgaggctgaagatcgtgtcatatggatggcatttgaggaatatgggtta
aacaaggaggtaccaaatattgttagtgaatttgttgggggcaccagtttagaaattcag
gagaggtacaaaactatcaaggaaaagaacattggaaggttggaccagccttctcaaaac
tcaggagaatatgaatctactattggcatatgtctagagaaaagcctgagtgctgcatta
gattcttttgataatcttttttgtcgccgttgcctgatttttgactgtcgtctgcatggc
tgttctcaacctttaatatatcatagtgaaaagcagacagtttggtctgatcctgaagga
gacaggaaaccttgcagtgatcagtgttaccttcagttaaaggtagtaaaaaatgtgaca
gaagattcaacttctgggtctgatcagaataagagaactacaattacagaagaggcagat
gtgatattggctccctccattatagaggaacctagtaatcagagtataataccttttcaa
acagaagttgattgtcatggatctctcaatttaaatgttcctatctcagtgagtgtggaa
aaacggaaagtcctaaatcagtcagacatgtcaccccgtgactcaacactccatcccaat
gattgtcagaattcttataaaaagctgaaggcaatctctgatgctgtagttactgtaaat
agtgattctagcaagaaaataagtttgggtgcatgtggtgaaagtatacatacaattact
agtgcaattttggacaaatctgttaaagataactcaattaaattaatagattcttctagc
acttgccctagtgatgagcaggacaaaagtattggtgatggaccaaaagatcctacaaat
gagacagaatttaagatgtccaattcaatggaggggatagttgatgggatgctaagtctc
tcagattggaaacctctggagaaagaactatacttaaagggagtagaactgtttggcaga
aacagttgcctcatagcaaggaacttacttcctggtctgaagacttgtatggaaatagct
agttacatgcattctggaggagtgtcaatgccccacggatctattgttgctcctagttca
atcatggaagaaaagggaaaatttgatgctgactgcacagaccaggagatgccatctagg
tcacggttgctgaggaaaaggggcaaaacaaggaagtttaaatattcttggaaatctgct
ggccacccatcaatatggaaaagaattgctgatgggaaaaaccaatcttgcaagcagtat
acaccatgtggatgtcagtcaatgtgtggaaaggaatgtacttgtattaatggtggaact
tgctgtgagaaatattgcggttgttcaaaaagctgcaaaaatcggttcagaggatgccat
tgtgccaagagtcagtgtagaagtcgacaatgcccatgttttgctgcaggacgggaatgt
gatccagatgtctgtcggaattgctgggttagttgtggggatggttcgttaggggagcca
cctcggcgtggagaagggcaatgtggaaatatgaggcttctattgagacaacaacaaagg
attctcttggcaaagtctgatgttgcaggatggggagccttcttgaagaacccggttaac
aaaaatgattacttaggagagtacacaggagaactgatctcccaccgagaagccgataag
cgtgggaaaatatacgatcgcgccaactcatcttttctttttgacttgaatgatcagtac
gttcttgatgcttatcgcaaaggagacaagttgaaatttgcaaaccactcatcaaacccc
aattgctatgcaaaggtgatgctggttgctggagatcaccgagtaggcatatttgccaag
gaacacatcgatgctagtgaggagctcttctatgattatcgttatggtcccgatcaagca
ccaccatgggcacgtaaacctgagggttctaagagagacgaatcaacagctcctcaaggc
agggctaagaaacaccagtctcattga

DBGET integrated database retrieval system