KEGG   Glycine max (soybean): 100796533Help
Entry
100796533         CDS       T01710                                 

Gene name
GAD
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00250  Alanine, aspartate and glutamate metabolism
gmx00410  beta-Alanine metabolism
gmx00430  Taurine and hypotaurine metabolism
gmx00650  Butanoate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100796533 (GAD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100796533 (GAD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100796533 (GAD)
   00430 Taurine and hypotaurine metabolism
    100796533 (GAD)
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100796533 (GAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 100796533
NCBI-ProteinID: NP_001276214
UniProt: A8C8H3
LinkDB All DBs
Position
11
AA seq 503 aa AA seqDB search
MVLSKTTSESDVSVHSTFASRYVRTSLPRFKMPEESIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEETEAAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKQEGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDDYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKITGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRDNMLVLKEGLEK
TGRFSIVSKDNGVPLVAFTLKDHTHFDEFQISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVADVEKVLHELDSLPARVISSTSVTVTAEENGKVVVAKKSAMETQRE
ITAIWKKFVLERKKNNDKMNGVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaaaccacctccgaatccgacgtctctgtccactcaaccttcgcttct
cgatatgtcagaacttcgcttcccaggtttaagatgccggaggagtcgataccaaaggag
gcagcgtatcaaataataaacgatgagttgatgttggatgggaacccaaggttgaacttg
gcatcatttgtgacaacctggatggagccagagtgtgataaactcatcatggctgccatt
aataagaactatgttgacatggacgagtatcctgtcaccactgagttacagaatcgatgt
gttaacatgatagctcatcttttcaatgcaccactagaagagactgaggctgcagttggt
gttggcacggttggctcatcagaggccataatgttagctggattggcattcaaaagaaag
tggcaaaacagaaggaaacaagagggaaaaccttttgacaaacccaacattgtcactgga
gccaacgttcaggtttgctgggagaaatttgcaaggtactttgaggtggagttgaaggag
gtgaagctccgtgatgattactatgtgatggaccctgaaaaggccgtggaattggtggat
gagaacactatttgtgttgctgctatccttggttcaacactaaatggagaatttgaagat
gtcaaacgcttaaatgatctcctaattgaaaagaataaaataactgggtgggacactcct
attcatgttgatgcagcaagtggtggcttcattgccccatttctttacccagagcttgag
tgggacttccggttaccactagtgaagagcatcaatgttagtggccacaagtatggtttg
gtctatgctggaatcggttgggttatctggagaagcaaggaggacttgcctgaggaactc
atctttcacatcaactatcttggtgctgatcaacccaccttcacccttaacttctccaaa
ggttctagccaagtcattgctcaatactaccaactaattcgccttggttttgagggatat
agaaacgtgatggaaaactgcagagacaacatgttggtgctgaaagaaggactagagaaa
acagggagattttcaattgtgtccaaagacaatggagtgcctttggtggcattcacactg
aaagaccacacccactttgacgaattccaaatctctgacttcttaaggcgctttgggtgg
atagtgccagcatacaccatgcccccagatgctcaacatgtcacagtgcttcgtgttgtc
atcagggaggacttctcgaggactctcgcagagcgcctcgtggccgatgttgagaaggtt
ctgcatgagcttgattcacttcctgctagggtcataagcagcactagtgtgacagtcact
gctgaagaaaatggcaaggtagtggttgctaagaagagtgctatggagactcagagggaa
atcactgccatttggaagaagtttgtgttggagaggaagaagaacaatgacaagatgaat
ggtgtttgttag

DBGET integrated database retrieval system