KEGG   Glycine max (soybean): 100796614Help
Entry
100796614         CDS       T01710                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00030  Pentose phosphate pathway
gmx00051  Fructose and mannose metabolism
gmx00052  Galactose metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
gmx01230  Biosynthesis of amino acids
gmx03018  RNA degradation
Module
gmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100796614
   00030 Pentose phosphate pathway
    100796614
   00051 Fructose and mannose metabolism
    100796614
   00052 Galactose metabolism
    100796614
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100796614
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gmx01009]
    100796614
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gmx03019]
    100796614
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100796614
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100796614
Messenger RNA biogenesis [BR:gmx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100796614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 100796614
NCBI-ProteinID: XP_006583042
UniProt: I1KGH5
LinkDB All DBs
Position
7
AA seq 464 aa AA seqDB search
MSNSEHNIITGHAGYVLEDVPHLSDYIPHLTTYPNPLQDNPSYSVVKEHSVDVDDTIAQK
VVVHKNSPRETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGV
HKVLGIEGGYRGFYSCNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQDRGI
NQVYILGGDGTQRGASVIFEEIRRRGLKVSVVGIPESVDNDIPVIDKSFGFDTAVEEAQR
AINAAHVEAESTENGIGVVKLMGRHSGFISMYATLASRDVDCCLIPESPFYLEGPGGLFE
FIRKRLAENGHMVIVISEGAGHELISESLSATNKQEASGNKLLQDVGLWLSQKIKDHFTK
SQKMDITLKYIDPTYMIRAVPSIASDNVHCTLLAQSAVHGAMAGYTGFAVGTVNGKHAYI
PFYRINEIEKKVVITDRMWARLLSSTNQPSFLNPKDITTHQTGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccaattctgaacacaacatcatcactggacatgctggctatgtccttgaagatgtc
cctcatctatctgactacatccctcacctcactacatatcctaatccgttgcaagataat
ccttcgtattcagttgttaaggagcattctgttgatgtggatgatactattgctcaaaag
gtagttgtacataagaatagcccaagagagactcattttcgccgtgctgggccgcgtcag
aaggtatattttgagtccgaggatgtgtatgcttgtattgtcacatgtggaggtctttgt
cctggtgtaaatacagtgatcagggaaatagtttgtgggttataccatatgtatggggtg
cacaaagtactgggaatagagggagggtatagaggtttttattcttgcaatactattcca
ttgacgccaaaggttgtgaatgacatccacaaacgtggtggaaccatccttggtacctct
caaggagaaggaggcaatgatacgttaaagattgttgatagcatccaggatcggggaatt
aatcaggtttacatacttggaggagatggaactcagagaggggcttctgtgatttttgag
gaaattagaagacgtggcttgaaagtttcagtggttggaattccagaatcggttgataat
gacatcccggttattgataagtcatttggttttgacactgctgttgaagaggcacaacga
gccataaatgctgctcatgtggaagcagaaagcactgagaatggtattggtgttgtcaag
ttaatgggtcgtcacagtgggtttatatctatgtatgcaactctcgccagccgagatgtg
gattgttgcttaattccagagtcacctttttacctcgagggtccaggtggactctttgag
ttcattaggaaaagactcgcagaaaacgggcacatggttatagtaatttctgaaggtgca
ggtcatgagcttatttcagaaagcctatctgctacaaataagcaggaagcttctggcaac
aagttacttcaagatgttggtctgtggttatcccagaagattaaggatcacttcacaaaa
agtcaaaagatggatataactctgaagtacattgatcccacctacatgatccgtgctgtt
ccaagtattgcatctgataatgtacattgcactctccttgctcaaagtgctgttcatggt
gcaatggctggatacacaggcttcgcagttggcacggtcaatggcaaacatgcttatatt
ccattttatcggataaatgaaattgagaagaaggttgttataactgaccgcatgtgggca
aggttactgtcttcaaccaatcaacctagcttcttgaatcctaaagatatcactacacat
caaacgggaaattaa

DBGET integrated database retrieval system