KEGG   Glycine max (soybean): 100797019Help
Entry
100797019         CDS       T01710                                 

Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Module
gmx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100797019
Enzymes [BR:gmx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     100797019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 100797019
NCBI-ProteinID: XP_003519173
UniProt: I1JGU8
LinkDB All DBs
Position
2
AA seq 532 aa AA seqDB search
MAISSTSNSLIPTKSLIPQSHPLIPNTRPALRPKPGPSPSIFAVHAAEPAKNPVVTDKPK
PQAQQPPPASARATKWAVDSWKSKKALQLPEYPSQEELESVLKTLEAFPPIVFAGEARTL
EEHLAEAAMGNAFLLQGGDCAESFKEFNANNIRDTFRIILQMSVVMMFGGQMPVIKVGRM
AGQFAKPRSDSFEEKNGVKLPSYRGDNINGDSFDEKSRIPDPQRMIRAYCQAAATLNLLR
AFATGGYAAMQRVTQWNLDFTDHSEQGDRYRELANRVDEALGFMAAAGLTVDHPIMRTTE
FWTSHECLLLPYEQSLTRLDSTSGLYYDCSAHMIWVGERTRQLDGAHVEFLRGVANPLGI
KVSDKMDPNELVKLIEILNPQNKAGRITVITRMGAENMRVKLPHLIRAVRRAGQIVTWVS
DPMHGNTIKAPCGLKTRPFDSIRAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSR
TVTFDDLSSRYHTHCDPRLNASQSLELAFIIAERLRKSRIRSQQPLAPLGVL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctcctccacttccaactccctcattcccaccaaatctctaatcccccaatcc
caccccctcattcccaacaccaggcccgccctccggcccaagcccggcccatccccttcc
atcttcgccgttcacgccgccgagcccgccaaaaaccccgtcgtcaccgacaagcccaag
ccccaagcccaacaacctcccccggcctcggcccgggcaacgaaatgggccgtggacagc
tggaagtcaaagaaagccctgcagctgcccgaatacccgagccaggaggagctggagtcc
gtcctcaaaaccctcgaggcttttcctccaatcgtcttcgccggtgaggccaggacattg
gaggagcatctcgccgaggccgccatgggaaatgccttcctcctccagggcggagactgt
gctgagagcttcaaggagttcaatgccaacaacatccgtgacaccttccgcatcatcctc
cagatgagcgtcgtcatgatgttcggcggccaaatgcctgtcatcaaggtggggagaatg
gcggggcaatttgcaaagcctcgttcggattcgtttgaggagaagaatggcgtgaagctt
ccgagttacagaggggataacattaacggagactctttcgacgagaagtcgaggattccg
gatccgcagaggatgattagggcttattgccaagccgcggccacgctgaatcttctcaga
gcttttgccaccggtggttatgctgctatgcagagggttactcagtggaatttggacttc
acggatcacagcgaacagggagataggtaccgagagcttgctaaccgagttgatgaggcc
cttggattcatggctgctgctgggctcacggtggaccatcccataatgagaacaactgaa
ttctggacatctcatgagtgcttattgttgccttatgaacaatccctcacaaggttggat
tcaacttctggtctctactatgactgttcagcccatatgatctgggttggagaacgaacc
aggcagcttgatggtgcccatgttgagtttctaagaggagttgctaatcccttgggaatt
aaggtaagtgacaagatggatccaaatgagctagttaaactcattgagatcttgaatcct
caaaacaaagcaggaagaattactgtgatcacgaggatgggagctgaaaatatgagggtg
aagcttccacatctcatcagggcagtgcgcagagcaggccaaattgtcacttgggtcagt
gatcctatgcatggaaacaccattaaggctccctgtggtcttaaaactcgccccttcgat
tccatcagggccgaagtgagagcattcttcgacgtacacgagcaagaaggaagccaccca
ggaggggttcatctagagatgacgggtcagaatgtgaccgagtgcattggtgggtcaagg
acggtcacatttgatgacttgagctcacgttaccacacacactgtgacccaaggctcaat
gcttcacaatctcttgagcttgctttcatcatcgctgagcgtttgagaaagagcaggatc
agatcgcagcaacctcttgcccctctaggagtactgtaa

DBGET integrated database retrieval system