KEGG   Glycine max (soybean): 100798079Help
Entry
100798079         CDS       T01710                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00071  Fatty acid degradation
gmx00592  alpha-Linolenic acid metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01212  Fatty acid metabolism
Module
gmx_M00087  beta-Oxidation
gmx_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100798079
   00592 alpha-Linolenic acid metabolism
    100798079
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100798079
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100798079
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100798079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100798079
NCBI-ProteinID: XP_003534202
UniProt: I1L4J2
LinkDB All DBs
Position
9
AA seq 724 aa AA seqDB search
MALPKVDFEVGADGVAVITMCNPPVNALAIPIIMGLKNRFDEAARRNDVKAIVLTGKGGR
FSGGFDISVMQKVHRTGDSSHLPDVSVELVVNSIEDSKKPVVAAVAGLALGGGLELAMGC
HARVAAPRAQLGLPELTLGIIPGFGGTQRLPRLIGLSKAVEMMLTSKPITSEEGRKLGLI
DAIVSSEELLNASRLWALEIGERCKPWVRSLHRTDKIGSLSEAREVLRTARQQVKKTVPH
LPQQLACVDVIEHGIVHGGYSGVLKEAEVFKQLVVSDTAKGLINVFFSQRAISKVPGVTD
IGLKPRNVKKAAVIGGGLMGSGIATALILGNIHVILKEINPEFLLKGIKTIEANVNGLVR
RGKLTKQKADAALSLLRGVLDYSEFKDVDLVIEAVIENISLKQTIFSDLEKICPPHCILA
SNTSTIDLDVVGKTTSSQNRIAGAHFFSPAHIMPLLEIIRTDKTSAQVILDLITVGKIIK
KTPVVVGNCTGFAVNKTFFPYSQGAHLLVNLGVDVFRIDTLIRNFGFPIGPFQLQDLAGY
GVAVATSKVFADAFSDRIFKSPLLDLLIKSGRNGKNNGKGYYIYEKAGKPKPDPSILPII
EESRRLCNIMPNGKPISVTDQEIVEMILFPVVNEACRVLEDGVVIRASDLDIASVLGMSF
PNYRGGIVFWADLVGANHIYTSLKKWAQLYGNFYKPSRYLEERALKGIPLSAPASSTPKS
MARL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcctaaggttgatttcgaggttggagctgatggggttgctgtcatcactatg
tgcaacccacccgtcaatgctttggccattccaattatcatggggttgaagaacagattt
gatgaggcagctaggaggaatgatgtgaaagctatagttttgactggcaaaggtgggaga
ttttctggtggatttgatatcagtgttatgcagaaggttcaccggactggggattcctcg
catctccctgatgtctcagtggaactagtagttaattcaattgaagattcgaagaagcct
gttgttgcagcagtagcagggcttgctcttggaggtggcttagaactggctatgggatgc
catgcccgtgttgcggctccaagagctcaattgggtctaccagagctgactcttggtatt
attcctggatttggaggaacacagcgtcttccaaggcttattgggctgtctaaagctgtt
gaaatgatgctgacatctaaaccaatcacatcggaagaagggaggaaattaggacttatt
gatgctattgtgtcttctgaggagttactaaatgcatctaggttgtgggcacttgaaatt
ggagagaggtgcaaaccttgggttcgttcacttcataggacggacaaaattggttctctg
tctgaagcacgtgaggtgttgagaactgccaggcaacaagtaaagaagactgttccacat
ttgcctcagcagctggcttgtgtagatgtgattgaacatggaatagtccatggaggctac
agtggtgttctaaaggaggcagaagtattcaaacaattggttgtatctgacaccgcaaaa
ggtttaattaatgtcttcttttctcagcgggcgatatcaaaggtgcctggcgtaaccgat
atcggccttaagcccagaaatgtgaaaaaagctgctgttattggaggaggtctaatgggt
tctggcattgctacagctcttatactaggcaacattcatgttatactcaaggaaatcaat
cctgaatttcttctgaagggaataaaaacaatagaagcaaatgttaatggcttagtaaga
agaggaaagttgacgaaacagaaggcagatgctgcactgtcactgcttagaggtgttctg
gattactcagaatttaaagatgtggacttggtcattgaggctgtaattgaaaatatcagt
ctcaaacaaactatatttagtgatcttgagaagatttgtcctccacactgcattttagca
tcaaacacatcaactattgaccttgatgttgttggtaaaacgaccagctctcaaaatcgc
attgcgggtgctcattttttcagtcctgcccacattatgcctcttttggagattatacga
accgataaaacatctgcacaagtgattcttgatctgataacagttggtaaaatcataaag
aagacacctgttgtggtgggtaattgtactggctttgcagtgaataaaacattcttccca
tattcacaaggtgcccatttgttggtcaacttgggcgtggatgttttcagaattgacaca
ttgatacgcaactttggctttccgattggtcctttccagcttcaagacttggctggctat
ggagttgccgttgctacctcaaaagtatttgctgatgctttttctgatcgcatatttaaa
tctccactgcttgatcttctgatcaaatctgggcgaaatggcaaaaacaatgggaaaggg
tactacatttatgaaaaggctggcaagccaaaacctgatccttcaatactaccaatcatt
gaggagtctagaagactttgcaatattatgcccaatggaaagcctatatctgttactgac
caagagatcgtggagatgatactcttcccagtagttaatgaggcatgccgtgttctagaa
gatggagttgttattcgagcatcagaccttgacattgcatctgttcttggaatgagcttc
ccaaattaccggggtggcattgttttctgggcagacttggttggggccaatcatatatat
accagcctaaaaaaatgggcacaattatatggtaacttctataaaccctcaaggtatttg
gaagaaagagcactcaaaggcattcccttgagtgcacctgcttcatctactccaaagtca
atggcacgtctatga

DBGET integrated database retrieval system