KEGG   Glycine max (soybean): 100802518Help
Entry
100802518         CDS       T01710                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00052  Galactose metabolism
gmx00500  Starch and sucrose metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100802518
   00500 Starch and sucrose metabolism
    100802518
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100802518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100802518
NCBI-ProteinID: XP_003534790
UniProt: A0A0R0I6Y6
LinkDB All DBs
Position
9
AA seq 897 aa AA seqDB search
MDTTTTIAPLLFCTCACLIFFSASLSEATVVGYGYTISTVNNYPIKNSLTANLNLIKSSS
VSGPDIPHLSLTASFENKDRLRVRITDSNHQRWEIPQEVIPRDSSSQHYPLGFLNTKQGS
HQPKDSLSLTHSDSDLVFSLHNTTPFGFTVSRKSSNDVLFHAAPDPSNPETFLVFKDQYL
QLSSSLPSQRASLYGFGEHTKSSFKLRPNQTLTLWNADIASANLDLNLYGSHPFYLDVRS
HSSDGKVKAGTTHGVLLLNSNGMDIVYGGDRITYKVIGGVFDLYFFAGSSPELVLEQYTQ
LIGRPAPMPYWSFGFHQCRWGYKNVSDLEDVVANYAKAGIPLEVMWTDIDYMDAFKDFTL
DPINFPLDKMRSFVDTLHKNGQKYVLILDPGISVNETYATYDRGLKADVYIKRNGNNYLG
QVWPGPVYYPDFLNPRSQAFWGGEIKLFRDLLPIDGIWLDMNELSNFITSPPIPSSNLDN
PPYKVNNVGDQRPINDKTVPATSLHFGNITEYNVHNLYGLLESKVTNKALKDITGKRPFI
LSRSTFVSSGKYAAHWTGDNAATWNDLAYSIPAILNSGIFGIPMVGADICGFEGNTTEEL
CGRWIQLGAFYPFARDHSVINSIRQELYVWDSVASSARKVLGLRYRLLPYFYTLMYEAHT
KGTPIARPLFFSFPEDVTTYEINSQFLLGRGVLVSPVLQSGATTVDAYFPKGTWFDLFNV
SNSVNAESGKYVTLDAPYDHINVHVGEGNILALQGEAMTTDAARKTAFQLVVVISSSRSS
YGQLYLDDGEALDMAGAKDQWTLVSFYGALHNNSVSVTSKVTNGRFALDQRWILDKVTFL
RIPKLAGNELSIVNGTSSMKKAIVKSQFDSSSQFVNVQVSKLSLLIGEEFQLEIEIK
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaccaccacaatcgctcctctactcttctgtacctgtgcttgtctcatcttc
ttctccgcttcattgtcagaagcaacagtagttggttatggctacaccatctcaactgtc
aacaattatcccataaagaattctttgactgcaaaccttaacctcatcaaatcctcctct
gtttccggacccgacattccacacctctccctcactgccagttttgagaacaaggatagg
ttgagagtaagaatcactgactccaatcaccaaagatgggaaattccacaagaagtgatt
ccaagagactcatcttcccaacattaccctcttggcttcctcaataccaaacaaggttcc
catcagccaaaagactctctgagcctcacacattcagactcagaccttgttttcagtctc
cacaacaccactccatttggcttcacagtctctcgcaaatcttccaatgatgtcctcttc
cacgccgcaccagacccttccaacccggaaacttttcttgtcttcaaagaccagtacctg
cagctctcttcctcccttccatcgcaaagagcctctctttacggcttcggggaacacacc
aagagctccttcaagctgcgaccgaaccagacccttacactttggaatgcagacattgca
agtgccaacctagacttgaacctttatggctctcaccctttttatttggacgtcagatca
cactcctctgatggaaaagtgaaggctggcaccacacacggggtgttgctgctcaacagc
aatggaatggacattgtgtatggtggtgatcgaattacttataaagtcattggtggggtt
tttgatctctactttttcgctggatcctctcctgaattggtgttggagcagtacactcaa
ctcattggaaggcctgctcccatgccttattggtcctttggttttcatcagtgtcgatgg
ggctacaagaatgttagtgatctcgaggatgtggttgccaactatgcaaaagcaggtata
ccccttgaagttatgtggacagatattgattacatggatgcatttaaagatttcacatta
gaccccattaactttccgctggataagatgagaagttttgttgatactcttcacaagaat
ggtcagaaatacgtgcttatattggatccaggtatcagtgtaaatgagacatatgcaacc
tatgatagaggtttgaaggctgatgtctatataaagaggaatggaaacaattatcttggt
caagtttggcccggaccagtttattatcctgattttctaaaccctcgcagccaagcattt
tggggtggggaaatcaaattatttagggaccttctccctattgatggtatttggcttgac
atgaatgagttatctaatttcattacttctcctcccattccatcttcaaatcttgataat
cctccttataaagttaacaatgttggagatcaacgacccattaatgacaaaactgttcca
gcaacatctttacactttggtaatatcactgagtataatgtccacaatttgtatggacta
ctagaatccaaagtaactaacaaagcattaaaggatataactggtaaaaggccattcatc
ctaagtagatcaacctttgtgagttctggtaagtatgctgcccactggactggagacaat
gctgctacatggaatgatttggcatactcaatccctgcgatattaaattctggaatcttt
ggaattccaatggttggagcagatatatgtggtttcgaaggaaatacaactgaagaactt
tgcgggcgttggatccagttgggggctttttacccctttgcaagagatcattcagtaata
aactccatccggcaagagctttacgtttgggattcagtggcttcatcagctaggaaagtg
cttggcctacgctatcgtcttctcccttatttctacacactaatgtatgaagcacataca
aaagggactcccattgcaagaccccttttcttttctttccccgaggatgtcaccacatat
gaaataaactcacagtttctattaggtagaggagttctggtgtcacctgtgctacaatcc
ggggcaaccactgttgatgcatactttcctaaaggaacttggtttgatctcttcaatgtc
tcaaattcagtgaatgcagaatcaggcaagtatgtcactcttgatgctccatatgatcac
ataaatgtgcatgttggggaaggtaatattttggccttgcaaggagaagcaatgacaact
gatgctgcgcggaaaactgcatttcaacttgtggtggttatcagtagcagcagaagtagt
tatggacaattgtacttggatgatggggaggcacttgatatggcaggggcgaaagatcag
tggacactggtaagcttttatggcgcgttacacaacaatagcgtttctgtaacatctaag
gtcactaatggaaggtttgctctggaccaaaggtggatcttagacaaggtgactttcttg
aggatacctaagctagcagggaatgagttgagtattgtgaatggaacaagttcaatgaag
aaggcaattgtgaagtctcaatttgatagctcctctcagtttgtcaatgtacaagtttca
aaattgtcgcttcttattggagaggaattccagctggagatagaaatcaagtag

DBGET integrated database retrieval system