KEGG   Glycine max (soybean): 100807673Help
Entry
100807673         CDS       T01710                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gmx  Glycine max (soybean)
Pathway
gmx03030  DNA replication
gmx03410  Base excision repair
gmx03420  Nucleotide excision repair
gmx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100807673
   03410 Base excision repair
    100807673
   03420 Nucleotide excision repair
    100807673
   03430 Mismatch repair
    100807673
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gmx03032]
    100807673
   03400 DNA repair and recombination proteins [BR:gmx03400]
    100807673
Enzymes [BR:gmx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100807673
    6.5.1.6  DNA ligase (ATP or NAD+)
     100807673
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100807673
DNA replication proteins [BR:gmx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100807673
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100807673
DNA repair and recombination proteins [BR:gmx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100807673
   NER (nucleotide excision repair)
    Other NER factors
     100807673
   MMR (mismatch excision repair)
    Other MMR factors
     100807673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 100807673
NCBI-ProteinID: XP_003551833
UniProt: K7MVF2
LinkDB All DBs
Position
18
AA seq 1402 aa AA seqDB search
MDSQTLDSTKLYLTALKTLQSEAPPTPSLPPLPSSIPHSKLIPHTRFLVDAFRHAGPHSH
SYFLSHFHSDHYSGLSPSWSRGVIFCSHTTAALLRRILHIPAAFIVPLPLRQPLRIDGAH
VTLLDANHCPGAVQFLFSVPRATADAAALRYVHTGDFRFCNSMVSEPALAPFVGADAVFL
DTTYCNPKFVFPSQEESIDYVASVVESVERECEHNSSDKVLFLVATYVIGKEKILLELAR
RFKRKIHVDARKMEVLRVLGYGENGEFTEDGKESNIHVVGWNLLGETWPYFRPNFVRMKE
VMAERGGSYSKVVGFVPTGWTYEVKRNRFAVKSKDLFKIHLVPYSEHSNYDELREYVKFL
KPKRVVPTVGLDVEKSDSKHADKMRKYFARLVDETANKQDFLRGFLRDPGEKGEAGFKAE
KVVSDALGPGQDMEEEEINALKKTEGDMGIGPVVAVGLSSFMEETYAQDPTLLNDEEKEK
IIQELTFCLPTWVTRNQLLDLISISGSNVIEAVSNFYERETEFHEQVISCQTPVSTSKCC
SLNGMDSLAKPCLNTNNTGKNIDIFPSQDSKLTNLRHTVPSPISPAKRKRSTDSKQNKKA
KVKAKSEPSGSKQATITRFFSKVIPEMPGGTQSDNSEPKLDQSSKVEDLLPTDDGQMYKD
EIDQFMQIINGTESLKKYAITIIEKTKGDINKALDIYYGNSENLGEKQISVQVESKIDRP
VVKKHASEELRIVPDIFDQKVLKDNVDATHLSLPPEKYNPKEHACWKDGQPAPYLHIART
FNLLEGEKGRIKATSLLCNMFRSLLALSPADVLPAVYLCTNKIAADHENKELNIGGSLVT
AALEEACGTNRLKIREMFNKFGDLGDVAQECRQTQRLLAPPTPLLIKDVFSALQKISVQT
GSRSTSRKKGIIVHLMRSCREKEMKFLVRTLVRNLRIGAMLRTVLPALAHAVAMNSCPTL
HQEGTAENIKEKLQVLSMAVVEAYNILPNLDLIVPSLMNKGIDFSVSSLSMVPGIPIKPM
LAKITNGIPQALKLFENKAFTCEYKYDGQRAQIHKLVDGSIRVFSRNGDESTSRFPDLID
IIKESSKPVASTFIMDAEIVGIDRKNGYRIMSFQELSSRGRGGKDTLVTSESIKVDICIF
VFDIMFANGEQLLGFPLRLRRKYLKDLFYDEKPGYFEYAKETTVEADDACLTCEATLTKI
NAFLEDALRSSCEGIMVKTLDVDAGYSPSKRSDKWLKVKRDYVEGLNDTLDLVPIGAWHG
NGRKAGWYSPFLMACFNPETEEYQSVCRVMSGFSDSFYIEMKQFFSGDKVLSKKPPYYQT
REAPDMWFCPQVVWEIRGADFTVSPVHHAAIGLVHPSRGISIRFPRFISCVSDRSPEECS
TAADIGEMFHSQTRKMDITTGD
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggattcacaaaccctagactccaccaaactctacctcaccgccctcaaaaccctccaa
tccgaagcccctcccacaccctccctccccccactcccctcttccatccctcactccaaa
ctcatcccccacacccgcttcctcgtcgacgccttccgccacgccggcccccactcccac
tcctacttcctctcccacttccattccgaccactactccggcctctccccatcctggtcc
cgcggcgtcatcttctgctcccacaccaccgccgccctcctccgccgcattcttcacatc
cccgccgcattcatcgtccccctccccctccggcagcctctccgcatcgacggcgcccat
gtcaccctcctcgacgccaaccactgccccggcgccgtccagttcctcttctccgtcccc
cgtgccaccgccgatgccgccgccctcaggtacgtccacaccggcgattttcgcttttgt
aattccatggtttccgaacccgccctcgcccccttcgtcggtgccgatgcggtgtttctc
gacaccacctattgtaatcctaagttcgtgttcccctcgcaagaggagtctattgattac
gttgccagtgtcgtggagagcgttgagcgtgagtgtgagcataatagtagtgacaaagtt
ttgtttcttgttgctacttatgtcattgggaaggagaagattttgcttgagcttgcacgc
aggtttaagaggaagatacacgtcgatgctaggaagatggaggttttgagggttcttggg
tatggggagaatggtgaatttactgaggatgggaaggagagtaatattcatgttgttggg
tggaatttgttgggggagacttggccttactttaggcctaattttgttaggatgaaggag
gttatggctgagagaggggggtcatactccaaggttgtcggctttgttccgaccggatgg
acctatgaagtgaagcggaataggtttgcggtcaagtccaaggatttgttcaagattcat
cttgtgccgtatagtgagcactcaaactatgatgagctcagggagtatgtgaagtttttg
aagccaaagcgggttgttccgaccgtgggtttggatgttgagaagagtgacagtaaacat
gctgacaaaatgaggaagtactttgctaggttggttgatgagactgccaacaagcaggat
tttttaaggggttttcttcgtgaccctggtgagaagggtgaagcgggtttcaaggctgag
aaggttgttagtgatgctcttggaccagggcaagacatggaggaagaagaaatcaatgca
ttgaagaagacagaaggtgatatgggtattggtccagttgtggctgtgggtttgtcttct
tttatggaagaaacttatgcacaagatcctactttgctgaatgatgaagaaaaggagaaa
ataattcaagaactgactttttgtttgcccacatgggtcacccgaaaccagttgttggat
ctgatcagcatctcagggagcaatgtcattgaagctgtttctaatttctatgaacgtgaa
actgaatttcatgagcaagtgatatcttgtcaaactcctgtttcaacatccaagtgctgc
tcattaaatggtatggattcacttgcaaaaccatgcctcaatacaaacaacactggcaaa
aatattgacatttttccaagtcaagactctaaattaactaacctgaggcatacagtgcct
agtcccatttctcctgccaaaaggaagagaagtactgacagtaagcaaaacaaaaaagcc
aaagtcaaagcaaaatctgaaccaagtggttcaaagcaggccacaattacaagattcttc
agtaaagtaatacctgagatgcctggtggtactcaatctgataattctgaaccaaagctt
gaccaaagctctaaagttgaagacttgttgccaactgatgatggacaaatgtacaaggat
gaaattgatcaatttatgcaaataataaatgggactgagtcattaaaaaaatatgccatc
actataattgagaagacaaaaggtgatatcaataaggcattggacatatattacggtaat
tctgaaaatcttggtgaaaagcaaatatcagttcaagtggagagcaaaattgatagacct
gtagtgaagaagcatgcatcagaggaattgagaattgtacctgatatttttgaccagaaa
gtcttgaaagataatgtagatgctactcacttatctctaccacctgagaaatacaaccct
aaagagcatgcgtgttggaaagatggacagcctgcaccatatttacatattgcaagaacc
ttcaacctgcttgagggtgagaaaggaaggattaaagctacatcattgctatgcaatatg
ttcagaagtttgttggccttatctccagcagatgtgcttcctgctgtgtatctatgcact
aacaaaattgctgcagaccatgaaaataaggaactgaatattggtggaagtttagtcact
gcagcacttgaagaggcatgtggaacaaatcgattgaaaataagggagatgtttaacaaa
tttggtgatcttggtgatgttgcacaagagtgtcgtcaaacacagagattgcttgcacca
cctacaccacttctaattaaggatgttttctctgcactacaaaagataagtgtacaaaca
ggcagtcgaagcacatctcggaagaaaggcatcattgttcatctcatgcgttcctgccgt
gagaaggagatgaagtttcttgttcggaccttggtcaggaacctaaggattggggcaatg
cttagaactgttttgcctgcattggctcatgctgttgctatgaattcttgccctactttg
caccaagaaggaactgcagaaaatataaaggagaaactacaggttctttctatggcagtt
gttgaagcatataacatactgccaaatttagatctcatagttccatctctcatgaacaaa
ggcattgatttttcagtttcaagtttatcaatggttccaggaatccctattaagcctatg
ctagcaaagatcaccaatggtattccccaagcattgaagctatttgaaaataaagcattt
acatgtgaatataagtatgatggtcagcgagctcaaattcacaaattagttgatggatca
attcgtgttttttcaagaaatggggacgaatcaacttcaagatttcctgatctgattgac
ataattaaggaatccagcaagccggttgcatcaactttcataatggatgctgaaattgtt
ggtattgacagaaaaaatggatataggattatgtctttccaggagctatcttcacgtgga
agaggtggcaaagatacattagttacttcagagagcattaaggtggatatttgcatcttt
gtctttgatatcatgttcgcaaatggagagcagttattgggttttcctctccgccttaga
cgaaagtatctgaaggatttgttctatgatgagaaacctgggtattttgaatatgcaaaa
gaaacaactgttgaagcagatgatgcttgcttaacctgtgaagccacattaactaagata
aatgctttcctggaagatgctcttcgctcttcatgtgaaggaattatggtgaaaacattg
gatgttgatgctgggtattctccatcaaagcgttctgacaaatggctaaaagtcaagcga
gattatgtggaaggattaaatgatactcttgatttagtaccgattggtgcttggcatgga
aatggaaggaaagctggatggtatagtccatttcttatggcatgtttcaatcctgaaaca
gaggagtatcaaagtgtatgtcgtgtgatgtctggattctcagattcattttacatagag
atgaaacaattcttctctggggacaaagtcttgtccaaaaaaccaccatattatcaaaca
agagaggcaccagacatgtggttttgtccacaagttgtttgggaaataagaggagcagat
tttactgtatccccagttcatcatgctgccattggtttagttcatccatctcgaggcatc
tcaatcagatttccaagatttattagttgtgtctcagacagaagcccagaagaatgtagc
acagctgccgatataggtgaaatgtttcattctcagactcggaagatggatatcacaact
ggagactga

DBGET integrated database retrieval system