KEGG   Glycine max (soybean): 100808564Help
Entry
100808564         CDS       T01710                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00564  Glycerophospholipid metabolism
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100808564
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100808564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 100808564
NCBI-ProteinID: XP_003519028
UniProt: I1JFY8
LinkDB All DBs
Position
2
AA seq 629 aa AA seqDB search
MTRLRRLGAAVGAAMATAYGGAILVSTPVSASDHSVGGSHLAAVREKIHDPFAVVPAREV
QRSALTGASAANPLDMLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFKLDYGQLKLVFHALEERKQLIDNAPHLCHALPCMTPCFDWFEVVYYWMG
LKMYDLVAGARLLHLSRYYSAKESVELFPTLAKEGKGRSLRGTVVYYDGQMNDSRLNVGL
ACTAALAGAAVLNHAEVVSLLKDEASERIIGARIRDNLTGKEFDTYAKVIVNAAGPFCDS
VRKMADKSARDMISPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITFLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAMDPTAKNTESISR
DHVVFEDHPGLVTITGGKWTTYRSMAEDAVNSAIKSGKLTPANGCITNNIRIVGGEGWDP
VSFTILSQQYMRMKVTYRGKVVPGVMDTASAKHLSHAYGTLAERVAAIAQNENLGKRLAH
GYPFLEAEVAYCARHEYCESAIDFIARRSRLAFLDTDAAGRALPRVIQILAAEHKWDKSR
QKEEMFKAKEFLETFKSSRNAQFYDGKHN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcctcaggcgactcggagccgccgtcggagcggccatggccactgcatacggc
ggcgccatcctcgtctccactccggtctctgccagcgaccacagcgtcggagggtcgcac
ctcgccgccgttcgggagaagatccacgaccccttcgccgtcgtgccggcgagagaggtc
cagcggtcggcgctgaccggcgccagcgccgcgaaccctctagacatgctcgtcatcggc
ggcggcgccaccggctccggcgtggcgctcgatgctgtcacccgagggctccgtgtcggt
ctcgtcgagagggaggatttctcctccggaacttcctctcgctccaccaagctcattcat
ggaggtgttcgttacctggagaaagctgtctttaaacttgactatggccaactgaagtta
gtattccatgcacttgaggagcgcaaacagcttattgacaatgcaccacacctatgccat
gctttgccttgcatgacaccttgttttgactggtttgaagtagtgtactactggatgggc
ttgaaaatgtacgatttggtcgcaggagcacgactcttgcacttatcgagatattattct
gcaaaagagtctgttgagctttttcccactctggcaaaggagggaaaaggtagaagcctg
aggggcacagttgtgtattatgatgggcagatgaatgattcacgacttaatgttggattg
gcttgcacagcggcattagctggtgcagcagtgctgaaccacgctgaagttgtatcctta
ctgaaggatgaagccagtgaacgcataattggtgcacgaattagggacaatttaactgga
aaagagtttgatacgtatgcaaaagtaattgtgaatgcggctgggccattttgtgattca
gtaagaaaaatggctgacaaaagtgcacgagacatgatttctcctagcagtggtgtacat
attatactccctgattattattctccagagggaatgggcttaattgttcccaaaactaag
gatggacgtgttgttttcatgctaccatggttgggacgaacggttgctggaactacagat
tccaacactagcattacctttcttccagaaccacatgaagatgaaatacaatttatattg
gatgccatctctgattaccttaatgttaaagtccgccgcactgatgttctttctgcctgg
agtggcattcgcccattagcgatggacccaacagctaaaaataccgagagtatctccagg
gatcatgttgtctttgaggatcaccctggtttggtcaccattactggtggcaagtggact
acctatcgaagcatggcagaagatgctgtcaattcagctataaagtctgggaagttgacc
cccgccaatggatgtatcaccaacaatatcaggattgttggtggtgaagggtgggatcct
gtttcctttaccattctttctcaacagtatatgcgcatgaaagtcacatataggggtaaa
gttgttcctggtgtgatggacactgcttcagcaaagcacttgtctcatgcatatggaaca
ttggctgaacgtgttgctgccattgctcagaatgaaaatttgggcaagcgacttgcccat
ggttacccttttttggaggctgaggtggcctactgtgcccgtcatgaatattgtgaatct
gcgattgacttcattgctaggagatctcgtcttgctttcctggacacggatgcagcagga
cgggcattacctcgtgtgattcaaatattggcagctgagcacaaatgggacaagtcaagg
cagaaggaagagatgtttaaagctaaagaatttttggagacttttaaatcctccagaaat
gctcaattctatgatgggaagcacaattag

DBGET integrated database retrieval system