KEGG   Glycine max (soybean): 100809840Help
Entry
100809840         CDS       T01710                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100809840
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100809840
Chromosome and associated proteins [BR:gmx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100809840
   Polycomb group proteins
    PRC2-EZH2 complex
     100809840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 100809840
NCBI-ProteinID: XP_006590652
UniProt: I1LHC7
LinkDB All DBs
Position
11
AA seq 861 aa AA seqDB search
MASKPPPSPSPSSSRSEPLVDLSSNKVEDSSPAGKDVLLVIDSLKKQVAAERVVSVKKRI
EENRQKLVGVTNHVCTMSMERRNFSITDTNRSLDLLTKRQKDAIDMHNGVHASNGDVESN
GYHDDSHGSTAVLLGSNVAVKNAVRPIKLPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRR
RIYYDQNGGEALICSDSEEETMDDEEEKRQFIESEDYILRMTVKEFGLTDIVLESLAQCF
SRNTSEIKAKYETLSIQDNAGGCSKAGDSEENSQSGNSFLEKDLEAALDSFDNLFCRRCL
VFDCRLHGCSQDLVFPAEKQPTWNPPDTENASCGPNCFRSVLKSERFAKTSSAQADEQKS
SGGALSRKKSSAKRRIKCSQSESASSNAKNISESSDSENGPGQDAVSASHSAPPKTKPVG
KGGIGKRNSKRVAERVLVCMQKRQKKTMVSDSDSISEALDRSSNDMVTDPHAMSSEDNTR
KEEFVDDNVCKPEITDNKSWKALEKGLLEKGMEIFGRNSCLIARNLLNGLKTCWDVFQYI
NCEDGKMSGPPGDVANSLMDGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKR
ITERKDQPCRQYNPCGCQTACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRS
RQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSD
VSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRK
GDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKP
EASGSKKEDGAPSSGRAKKLA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaagcctccgccttcgccctcgccctcttcttccagatcagagcctctcgtt
gatctctcctcaaataaagtggaggattcaagtcccgctggtaaagatgtgttactggtt
attgattctttgaagaaacaagttgctgcagaacgggttgtttctgtaaagaaaagaata
gaggaaaacagacagaagctggttggtgtcactaaccatgtctgcacaatgtcaatggag
agaaggaacttcagcattactgatacgaatagaagtctggacctacttacaaagaggcaa
aaagatgcaattgatatgcacaacggtgttcatgcgagtaatggtgatgtggagagcaat
ggctatcatgacgatagccatggttccacagcagttcttctagggtctaatgttgctgta
aagaatgctgttcgtcctatcaagttacctgaagtaaaaaaattgcctccttacactaca
tggatttttttggacagaaatcaaagaatgaccgaggatcagtcagttgtaggccggaga
cgaatttattatgatcagaatggtggagaagcacttatttgcagtgacagtgaagaggaa
actatggacgatgaagaggagaaaagacaatttatagaatcagaagattatatacttcgc
atgactgtcaaagagtttggtttaactgacattgttctggagtcgttggctcagtgtttt
tctagaaacactagtgaaattaaggcaaagtatgaaactctcagtattcaagacaatgct
ggtggctgttccaaggctggggattctgaagagaattctcaaagtggcaattcttttctg
gaaaaggatcttgaagcagctcttgactcttttgacaacctcttttgtcgacgatgcctt
gtttttgattgtagattacatggatgttcacaagatcttgtcttccctgctgagaagcaa
cctacatggaaccctcctgatactgaaaatgcatcctgtgggccaaattgtttccgatcg
gtacttaagtcggaaagatttgccaaaacatcctctgcccaggctgatgaacagaagtcc
tctggtggtgctttatctaggaaaaaatcttctgctaagaggcggataaaatgtagccaa
agtgaaagtgcttcatctaatgcaaaaaacatatcagagagtagtgactcagagaatggt
cctggacaagatgctgtctcagcctcacactcagcacctcctaaaactaaacctgtgggg
aaaggtggaattggtaaaaggaacagtaagcgagtggcagaacgagtcctagtatgcatg
cagaagcggcagaagaaaacaatggtttctgattctgattccattagtgaagctcttgac
cgttcatcgaatgatatggtcactgacccacatgccatgagcagtgaagacaacacgagg
aaagaagagtttgtagatgacaatgtttgtaaaccagaaatcactgataataaatcttgg
aaagctcttgaaaagggacttttagagaaaggaatggagatttttggtagaaacagttgc
ttaatagctagaaatctcttaaatggcctaaagacgtgttgggatgttttccaatacata
aattgtgaagatggaaagatgtctggtcctcctggggatgttgcaaattccctcatggac
ggctattccaagggtaataatgaagtgagacgaaggtctagattcttacgtagaagagga
agagtccgtcgattgaagtacacctggaaatctgctgcttatcattcaattaggaaaagg
attacagagagaaaggatcaaccctgccgacagtataatccatgtggttgccaaacggct
tgtggaaagcagtgtccttgtcttcaaaatggaacctgctgtgagaagtactgtggatgc
cccaagagctgcaagaatcgatttcgtggctgtcattgtgctaagagtcaatgcagaagc
cgtcaatgtccatgttttgctgcagatagggaatgtgatccagatgtttgtaggaattgt
tgggtcagttgtggcgatggtacacttgggattcctagccaaagaggggacaattatgaa
tgtagaaacatgaagcttcttctcaaacaacagcaaagggttcttcttggaaggtctgat
gtatccggctggggagccttcttaaagaatagtgttggtaagcatgaataccttggagag
tatactggagagttgatttctcatcgggaagcagataagcgaggaaagatatatgaccgt
gaaaattcatcttttctctttaatttgaatgatcagtttgttcttgatgcttaccgaaag
ggtgataaattgaagtttgcgaaccattctcctgacccaaattgttatgcaaaggttatt
atggttgctggagatcatagggtaggcatttttgccaaggaacggatttgtgccggggag
gagctgttctatgattatcgttatgagccagatagggctcctgcgtgggctcggaagcca
gaggcatctggatcaaaaaaagaggatggggctccttcaagtggtcgtgcaaagaagctt
gcttaa

DBGET integrated database retrieval system