KEGG   Glycine max (soybean): 100809938Help
Entry
100809938         CDS       T01710                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1 isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00562  Inositol phosphate metabolism
gmx01100  Metabolic pathways
gmx04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100809938
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100809938
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gmx01009]
    100809938
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100809938
    3.1.3.48  protein-tyrosine-phosphatase
     100809938
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100809938
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100809938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 Y_phosphatase3 DSPc Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100809938
NCBI-ProteinID: XP_003531839
UniProt: K7L8K6
LinkDB All DBs
Position
8
AA seq 417 aa AA seqDB search
MGLKFTKQGPPKIEDPSLHNQMINYLTKNFIRNLVSKQRRRMLIAGYDLDMSYITDRVLA
MSFPAQRMRAMYRNPLWQVKSVLDMRHYDHYKIYNLCIEESYDPDNFYGRVEAYPFDDNH
VPSLEMIKAFCESVDSWLSSDPKNIAVIHCMAGKGRTGLMVSAYLTYCGMSADEALQLYA
DRRTTNNEGVSIPSQRRYVAYWDSLLSNSVPRGTGNGPTKVNLPQPCGRELRRIRLYDTI
NIDTIFFVISELHEIPNEVYRPPVEAYRGCCRQIKKGYQRNNSPRYYISILEGDKDGNQS
ETEEPRIVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRLTFYEKMIGGRLFYCCFNTAF
IRNSLLQLPIQELDKVGKKGTSICGPDFCLELLFGPANAGYSSSSISNDEYSNDDSL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggggttgaaatttacaaagcagggaccacctaaaattgaggatccaagtttacataat
caaatgatcaattaccttaccaagaattttattcgcaacttggtatctaagcaacgaaga
agaatgcttattgctggttatgatcttgacatgtcatatatcacagaccgagtattagca
atgtcatttccggcacaacgtatgcgagcaatgtatcgaaatcctctatggcaagtcaaa
tctgtgttggacatgagacattatgaccattataagatctataatctctgtatagaagaa
agttatgatccagataacttctatggacgcgtggaagcatacccctttgatgataaccat
gtgccatctcttgaaatgatcaaagctttctgtgaaagtgtggattcatggctgtcaagt
gacccaaaaaatattgctgttattcattgcatggcgggaaagggtagaactggattaatg
gtgagtgcatacctaacttattgcggcatgtcagcagatgaggctcttcaattgtatgca
gatagacggacaaccaataatgaaggagtatcaataccaagccagcgtcgatacgtagca
tactgggatagtctactttcaaattctgtcccaaggggaactggaaatggaccgacaaag
gtgaacttgcctcagccatgtggcagagaattacggcgaatccggctttatgatacaatc
aacattgacacaatattctttgttatctcagagctacacgagattcctaatgaggtgtat
cgtccaccagtggaagcttatcgtggctgctgtagacagattaagaaagggtatcagaga
aataatagtcctcgctattatatctctattcttgaaggtgataaagatggaaatcaatca
gaaacagaagaacctcgcattgtagttcaaatggacacagagagtccagcaatataccaa
aaatcatgtttggaccattattttgataaacctatacaagtaacaggagatgtacggctc
acattctatgagaaaatgataggagggcgcctgttctactgctgttttaatacagctttt
attaggaacagcttactacagctcccaatacaagagttggacaaagttgggaagaaagga
acatcaatatgtggccctgacttctgcttagaattattgtttggtcctgctaatgcagga
tactcatcgtcaagtatatccaatgatgaatattctaatgatgattctttataa

DBGET integrated database retrieval system