KEGG   Glycine max (soybean): 100811501Help
Entry
100811501         CDS       T01710                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00053  Ascorbate and aldarate metabolism
gmx00071  Fatty acid degradation
gmx00280  Valine, leucine and isoleucine degradation
gmx00310  Lysine degradation
gmx00330  Arginine and proline metabolism
gmx00340  Histidine metabolism
gmx00380  Tryptophan metabolism
gmx00410  beta-Alanine metabolism
gmx00561  Glycerolipid metabolism
gmx00620  Pyruvate metabolism
gmx00903  Limonene and pinene degradation
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100811501
   00053 Ascorbate and aldarate metabolism
    100811501
   00620 Pyruvate metabolism
    100811501
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100811501
   00561 Glycerolipid metabolism
    100811501
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100811501
   00310 Lysine degradation
    100811501
   00330 Arginine and proline metabolism
    100811501
   00340 Histidine metabolism
    100811501
   00380 Tryptophan metabolism
    100811501
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100811501
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    100811501
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100811501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 100811501
NCBI-ProteinID: XP_003527026
UniProt: I1KCH8
LinkDB All DBs
Position
6
AA seq 540 aa AA seqDB search
MATRRLSLLLSRSLSSTSFQAASLLHSLGRNSGKWGNFNRFSTAAAVEDLITPQVPITYT
KHLINGQFVDAASGKTFPTYDPRTGEVIAQVAEGDAEDINRAVSAARKAFDEGPWPKLTA
YERCKIILRFADLVEKHGDELAALETWNNGKPYEQSATAELPTFVRLFRYYAGWADKIHG
LTVPADGNYHVETLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVILKTAEQTPLTA
LYVAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTETGKVVLGLAAQSN
LKPVTLELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHEHIYDEFLEK
AKARALKRVVGDPFKKGVEQGPQIDVEQFQKVLRYIKSGIESKATLECGGDQIGSKGFFV
QPTVFSNVQDDMLIAKDEIFGPVQTILKFKDIDEVIRRSNATHYGLAAGVFTKNVHTANT
LMRALRVGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVSPVKKPAWL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcgaagactttcattgctcctctctcgctctctatcttccacttcttttcaa
gctgcttctctacttcactcactagggagaaactctggcaagtggggaaactttaacaga
ttcagcactgcagcagcagttgaggatttaatcactccacaagttccaataacatacact
aagcatctgataaatggacaatttgtggatgctgcttcagggaaaacttttccaacatat
gacccacgcacaggagaagtgattgctcaagttgctgaaggtgatgcagaagatatcaac
cgtgcagtatcggcagctcgcaaggcctttgatgaaggaccttggccaaaattgactgct
tatgaaagatgcaagataatactgcgctttgctgatttggttgagaaacacggtgatgaa
cttgcagctctggagacatggaacaatggaaagccttatgaacagtctgccactgctgaa
ttaccaacgtttgtgcgtttgtttcgttactatgctggttgggcagataaaatccatggt
ctgacagtgcctgctgatggaaattatcatgtggagacattgcatgaaccaattggtgtt
gcaggacaaatcataccttggaactttcctctcctcatgtttgcttggaaagttggacca
gctcttgcatgtggaaatactgtcatccttaagactgctgaacaaacacctttaacagct
ctctatgtagcaaaactttttcatgaggctggtcttccaccaggtgttttgaatgtagtt
tctggctatggtccaactgctggtgcagctctagcaagtcatatggatgttgacaagcta
gcattcactggatctaccgagactggaaaagttgtgcttggattggctgcgcaaagcaat
ttgaagcctgtgacattggaacttggagggaaatcacctttcatagtgtgtgaggatgct
gatgttgaccaggctgtagaacttgcgcactttgctttgttctttaatcaggggcaatgt
tgctgtgctgggtctcgtacctttgtacatgagcatatctatgatgagttcttggagaaa
gcaaaggctcgtgctttgaaacgtgttgttggggatcccttcaaaaagggtgtcgaacaa
ggacctcagattgatgtggaacaattccagaaggtccttaggtacataaagtccggtatt
gaaagcaaggccacccttgaatgtgggggtgaccaaattggctcaaagggcttctttgtc
cagcccactgtcttctcaaatgttcaggatgacatgttgatagcaaaagatgaaatattt
ggccctgtacaaaccatcttgaagttcaaggacatcgacgaagtaattcgaaggtcaaac
gcaacgcactatggtctagctgcaggagttttcactaagaatgtgcacacagccaacact
ttgatgcgagcactgagggttggaacagtatggatcaattgctttgatgtttttgatgct
gcaattccctttggagggtacaaaatgagcggcattggcagggagaagggtatctacagt
ctcaacaattacctgcaagtgaaagctgtggtttcaccagtgaagaaacctgcatggttg
tga

DBGET integrated database retrieval system