KEGG   Glycine max (soybean): 100815376Help
Entry
100815376         CDS       T01710                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100815376
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100815376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100815376
NCBI-ProteinID: XP_003538169
UniProt: I1LKZ3
LinkDB All DBs
Position
11
AA seq 204 aa AA seqDB search
MQLAMAANAVVSPSPFRPQPFLRSSFSGVSVKLTPQSITLSRSKPLTVFAATKKAVAVLK
GTSAVEGVATLIQEDDGPTTVSVRITGLTPGLHGFHLHEYGDTTNGCISTGAHFNPNKLT
HGAPEDEVRHAGDLGNIVANAEGVAEATIVDNQIPLSGPNSVVGRALVVHELEDDLGKGG
HELSLTTGNAGGRLACGVVGLTPA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagctagcaatggcggccaacgctgtcgtttcaccgtcgccgttccgacctcagccc
tttctccggtcatccttctccggcgtctccgtcaagctcactccccaatccataacgctt
tcacgctccaagcccctcaccgtcttcgccgccaccaagaaggccgtcgccgtcctcaag
gggacctccgccgtcgaaggcgtcgccactctcatccaagaagacgatggcccgacgaca
gtttctgttcgcatcactggccttactccggggcttcatggttttcacctacatgagtat
ggtgatacgacaaatgggtgtatttctacgggagcacattttaatcctaataaattgaca
catggtgctcctgaggatgaagtccgtcatgcgggtgacctgggaaacatagttgctaat
gcagagggggttgcagaggctacaattgtggataatcagataccactctctggccccaat
tcagtagttggaagagccttggtggtccatgagcttgaggatgaccttggaaagggtggg
catgaactcagtttgacaactggaaatgctggtggaagattagcatgtggtgtggttggt
ttgactccagcataa

DBGET integrated database retrieval system