KEGG   Glycine max (soybean): 100815377Help
Entry
100815377         CDS       T01710                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00020  Citrate cycle (TCA cycle)
gmx00190  Oxidative phosphorylation
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100815377
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100815377
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100815377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 100815377
NCBI-ProteinID: XP_003553891
UniProt: A0A0R4J5X9
LinkDB All DBs
Position
19
AA seq 277 aa AA seqDB search
MATGLLKRAAQRLPSSPGFKLALLRAHASEAQAQQVEPKARGTPTLKTFQIYRWSPENPS
KPELKDYQINLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL
TKIPSEGAATTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPEPGKEILQSKKE
REKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLDAIND
EFKLYRCHTILNCARACPKGLNPGKQISHIKSLQPKA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagggttactgaagagggcggcgcagaggctcccctcctcgccggggttcaag
ctggccctcctccgggcccacgcgtcggaggcccaggcccagcaggtggagcccaaggcc
cgcggcaccccgaccctcaaaaccttccaaatctaccgctggagcccggagaacccctca
aagcccgagctcaaggactaccagatcaacctaaaggagtgcgggcccatggtcctggac
gcgctcatcaagatcaagaacgagatcgacccgagcctcacgttccgccgctcgtgccgc
gaggggatctgcggctcctgcgccatgaacatcgacggttgcaacggcctcgcgtgcctc
accaagatcccctccgaaggcgccgccaccacgatcacccctctgccacacatgttcgtg
atcaaggacctcgtcgtcgacatgacgaacttctacaatcagtacaagagtatcgagccg
tggctcaagaggaagaacccaccggagccggggaaggagattctacagagcaagaaggag
agggagaaactcgatgggatgtacgagtgcatactgtgcgcctgctgtagcacgtcctgc
cccagctactggtggaaccccgagtcctacctcggtcccgccgcgttgctccacgctaat
aggtggataagtgacagtcgtgatgagtacactaaggagagattggatgccattaatgat
gaattcaagctctatcgctgccacaccatattgaactgtgctcgagcctgcccaaagggg
ttaaacccaggaaagcaaatctcacatatcaagtcacttcagcctaaagcataa

DBGET integrated database retrieval system