KEGG   Glycine max (soybean): 100817945Help
Entry
100817945         CDS       T01710                                 

Definition
(RefSeq) uncharacterized protein LOC100817945
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00061  Fatty acid biosynthesis
gmx00780  Biotin metabolism
gmx01100  Metabolic pathways
gmx01212  Fatty acid metabolism
Module
gmx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100817945
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    100817945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gmx01004]
    100817945
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     100817945
Lipid biosynthesis proteins [BR:gmx01004]
 Fatty acid synthase
  Component type
   100817945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 100817945
NCBI-ProteinID: XP_003547614
UniProt: I1MDV8
LinkDB All DBs
Position
15
AA seq 223 aa AA seqDB search
MAASAFSNTLVSPISLSSKAKAKAISLQPKFPLVKFPNPRSHPLSRKTTSLTTFCSSDAA
NAPQHDTPIELRYPAFPTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTIND
NFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRKPVIAGD
TLVMRMTLTKLQKRFGIAKMEGKAYVGGEVVCEGEFLMAMGSE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcagctttctccaacacattggtttctcccatttctctttcatccaaagcc
aaagccaaagccatttcattgcaacccaaatttccacttgtcaaattccccaaccccaga
tcccatcccttgtcgaggaaaacgacgtcgctcaccacgttttgttcctccgatgctgcc
aatgctcctcaacatgacaccccaattgaattaaggtatcccgcattcccaaccgtcatg
gacatcaaccagattcgtgacattttgccccacaggtttccttttcttctggtggataga
gtgattgaatacaatcctggagtttctgcagtggccataaagaatgtgacaataaatgac
aacttctttcctggacattttccagaaaggccaatcatgcctggtgttctaatggtcgag
gcaatggcacaagttggtggtttggtcatgttgcaacctgaagtgggaggttctcgtgaa
aacttcttctttgctggaatagacaaagtgcggtttcgtaagcctgtgatagctggggac
accttagttatgagaatgacacttactaagctgcaaaagcgatttggaatagcaaagatg
gaagggaaggcatatgttggaggtgaagttgtgtgtgagggtgaatttttgatggcaatg
gggagtgaataa

DBGET integrated database retrieval system