KEGG   Glycine max (soybean): 100818908Help
Entry
100818908         CDS       T01710                                 

Definition
(RefSeq) uridine nucleosidase 1
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00240  Pyrimidine metabolism
gmx00760  Nicotinate and nicotinamide metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100818908
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100818908
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     100818908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 100818908
NCBI-ProteinID: XP_014629395
LinkDB All DBs
Position
3
AA seq 299 aa AA seqDB search
MASLVNNANGAVNGFPGISQKLIIDTDPGIDDSMAILMAFQSPDVEVLGLTTIFGNTTTE
LSTLNALLLCEMAGREDIPVAQGSHEPLKGGKPRVADFVHGKDGLGNTFLPPPKGEKIEK
SASEFLVEKVSEYPGEVSVLALGPLTNLALAIKRDSSFASKVKRIVILGGAFFALGNVNP
AAEANIHGDPEAADIVFTSGADIVVIGINITTQVQFTDADLLELKESKGKYAPFLSDICK
FYRDFHVKSDGVHGIFLHDPVSFVAVVRPDLFTYKKGVVRVETQGICVGHTLMDQGLKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgcttgtcaacaacgctaacggcgccgtcaatggttttcctggaatatcccag
aagctcattatcgatacagaccctgggatcgatgatagcatggccattcttatggctttt
caaagtccagatgtggaggttctgggtttgacaaccatttttggtaatacaactaccgaa
ctttcaacactcaatgctttgcttttgtgtgagatggcaggccgtgaagatattccagtt
gcacagggaagccatgagccattgaagggtggaaagcctcgtgttgctgattttgttcat
ggtaaagatggactagggaacacattcctacccccacctaaaggtgagaaaattgagaaa
agtgctagtgagtttttggtagagaaagtctctgaatatcctggtgaagtatctgtgcta
gcacttggaccactaacaaatttggctttggcaatcaaaagggattcttcctttgcaagc
aaagtgaagagaatagttatacttggtggtgcattctttgccttggggaatgtgaatcct
gctgcagaagccaatatccatggagacccggaagccgcagatattgtgtttacctctggg
gcagatattgttgttattggaataaacattacaacccaagtccaattcacagatgctgat
ctcctcgaactgaaggaatctaaaggaaagtatgctcccttcttgagtgacatatgcaaa
ttctatagggactttcatgtaaaatctgatggtgtccacggaattttcctccacgatcct
gtaagttttgtggcagttgtgcgtccagatcttttcacatacaagaagggggtagtgagg
gtagaaacacaaggcatctgtgttgggcatacacttatggaccaaggattgaaaaaatga

DBGET integrated database retrieval system