KEGG   Glycine max (soybean): 100820630Help
Entry
100820630         CDS       T01710                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00040  Pentose and glucuronate interconversions
gmx00051  Fructose and mannose metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100820630
   00051 Fructose and mannose metabolism
    100820630
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100820630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NCD3G PALP Pyr_redox_2 UDPG_MGDP_dh_N Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 100820630
NCBI-ProteinID: XP_003548224
UniProt: I1MQ30
LinkDB All DBs
Position
16
AA seq 364 aa AA seqDB search
MGKGGMSIDEHGEGKEENMAAWLVGMNTLKIQPFKLPTLGPHDVRVRMKAVGICGSDVHY
LKTLRCAHFIVKEPMVIGHECAGIIEEVGSQVKSLVPGDRVAIEPGISCWHCNHCKHGRY
NLCDDMKFFATPPVHGSLANQIVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIG
PETNVLIMGAGPIGLVTMLAARAFGAPKTVIVDVDDHRLSVAKSLGADDIIKVSTNIKDV
AEEVVQIQKVMGAGIDVTFDCAGFDKTMSTALSATQPGGKVCLVGMGHSEMTVPLTPAAA
REVDVVGVFRYMNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSARGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggggggaatgtcaattgatgaacatggagaaggcaaagaagagaatatggct
gcttggcttgttggaatgaacactctcaagattcagcctttcaagcttcctactttggga
ccccatgatgtcagagttagaatgaaggctgttggtatctgtgggagtgatgttcactac
ctcaagacactgaggtgtgctcactttatagttaaagaaccaatggttattggtcatgag
tgtgctgggatcatagaagaagttggtagtcaggtaaagagtttggtgcctggtgaccgt
gtggcaattgagcctgggatcagttgttggcattgcaaccattgcaaacacggtcgatat
aacttatgcgatgatatgaagttttttgctactccaccagttcatggttccctggctaat
cagatagtgcatcctgcagacctatgttttaagctgccagacaacgtgagcctagaggag
ggagcaatgtgtgaacccttaagtgttggtgttcatgcttgtagaagagctaatattgga
ccagaaacaaatgtgttgatcatgggagcagggcccataggacttgttacaatgctggca
gctcgtgcgtttggggcacccaaaacagtcattgtggatgttgatgaccatcgtttatct
gttgcaaaatctcttggtgcagatgatattattaaagtctcaacaaacattaaggatgtg
gctgaagaagttgtgcagatacagaaggttatgggagctggtatagatgttacctttgat
tgtgctggttttgacaaaaccatgtctacagcactgagtgctactcagccaggtggcaaa
gtttgcctagtgggaatgggacattctgaaatgactgtcccactcaccccagctgcagca
agggaagttgatgtggttggagtttttcgctatatgaacacatggcctctttgccttgag
tttctaaggagtggcaaaattgatgtgaaaccccttataacgcacaggtttggattctct
caaaaggaagtggaagaagcctttgaaacaagtgctcgtggtggtaacgccatcaaggtc
atgttcaatctttag

DBGET integrated database retrieval system