KEGG   Glycine max (soybean): 3989271Help
Entry
3989271           CDS       T01710                                 

Gene name
rbcL, GlmaCp003
Definition
(RefSeq) RuBisCO large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00630  Glyoxylate and dicarboxylate metabolism
gmx00710  Carbon fixation in photosynthetic organisms
gmx01100  Metabolic pathways
gmx01200  Carbon metabolism
Module
gmx_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gmx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
gmx_M00532  Photorespiration
gmx_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3989271 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3989271 (rbcL)
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3989271 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 3989271
NCBI-ProteinID: YP_538747
UniProt: P27066
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYL
NATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttgggttcaaagctggtgttaaagattat
aaattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaaccaggagttccgcctgaagaagcaggtgccgcggtagccgccgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagtcttgatcgttac
aaagggcgatgctacggccttgaacctgttgctggggaagaaaatcaatatattgcttat
gtagcttatcccttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtcggtaatgtatttgggttcaaggccctgcgtgctctacgtctggaggatttgcgaatc
cctactgcttatattaaaactttccaaggtccgcctcatggcatccaagttgagagagat
aaattgaacaagtatggtcgtcccctattaggatgtactattaaacctaaattggggtta
tccgctaagaattatggtagagctgtttatgaatgtcttcgtgggggacttgattttacc
aaagatgatgaaaatgtgaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagccatttttaaatcacaggctgaaacaggtgaaatcaaagggcattacttg
aatgcaactgcgggtacatgcgaagaaatgatgaaaagagctgtatttgccagagaatta
ggcgttcctatcgtaatgcatgattatttaacggggggattcactgcaaatactagcttg
gctcattattgccgagataatggtctacttcttcatatacaccgtgcaatgcatgcagtt
atcgacagacaaaagaatcatggtatgcactttcgtgtactagctaaagcattacgtttg
tctggtggagatcatgttcacgccggtaccgtagtaggtaaacttgaaggggaaagagaa
atcactttaggttttgttgatttactacgtgatgattttgttgaaaaagatcgaagtcgc
ggtatttatttcactcaggattgggtttctctaccaggtgttttgcctgtagcttcggga
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattctgtactc
caatttggcggaggaactttaggacacccttggggaaatgcaccaggtgctgtagctaat
cgagtagctcttgaagcatgtgtgcaggctcgaaatgaaggacgcgatcttgctcgtgaa
ggtaatgaaattatccgtgaggctagcaaatggagtcctgaattagctgctgcttgtgaa
gtatggaaggagatcaaatttgaattcgaagcaatggatactttgtaa

DBGET integrated database retrieval system