KEGG   Glycine max (soybean): 547756Help
Entry
547756            CDS       T01710                                 

Gene name
PEPC4
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00620  Pyruvate metabolism
gmx00710  Carbon fixation in photosynthetic organisms
gmx01100  Metabolic pathways
gmx01200  Carbon metabolism
Module
gmx_M00168  CAM (Crassulacean acid metabolism), dark
gmx_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
gmx_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
gmx_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    547756 (PEPC4)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    547756 (PEPC4)
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     547756 (PEPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 MCM_N
Motif
Other DBs
NCBI-GeneID: 547756
NCBI-ProteinID: NP_001237394
UniProt: Q6Q2Z8
LinkDB All DBs
Position
12
AA seq 966 aa AA seqDB search
MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC
YELSAEYEGEHKPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LLKKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPQFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANMYFSQIEDLMFELSMWRCTDELRVRAHELHRSSKRDAKHYIEFWKQI
PPNEPYRVILGDVRDKLYNIRERARHLLANGTSDIPEETTFTNVEQFLEPLELCYRSLCA
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLDIGSYREWPEEK
RQEWLLSELSGKRPLFGHDLPKTEEITDVLETFRVISELPSDNFGAYIISMATSPSDVLA
VELLQRECHVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYRNRIDGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIAT
KEYRSVVFKEPRFVEYFRCATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGSAFKHVVEKDPKNLQMLQDMYNQWPFFRVTLDLVEMVFAKGDPGIAALFD
KLLVSEELRPFGENLRAKYEETKSFLLQVAGHKDILEGDPYLKQRLRLRDSYITTLNVLQ
AYTLKRIRDPDYHVKLRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgtaacatcgagaagatggcctcaattgatgctcaactgaggttgctggcg
ccacgcaaggtgtctgatgatgacaaactcgttgagtatgatgccttgttgttggatcgt
ttccttgacattcttcaggatttgcatggtgaagatatcagacaaacggtccaagattgt
tacgagctgtcagctgagtacgaaggagagcataagcctgaaaagttggaggaacttggg
aatatgctgacgggtcttgatgctggggattcaattgttattgccaagtcattttctcac
atgctcaatttggccaacttggcagaagaagttcaaattgcgtatcgaagaaggatcaag
ttactgaagaagggtgattttgctgatgagaactctgccattactgagtcagacattgaa
gagaccttcaagaagcttgtggctcaactgaagaagacaccccaggaaatctttgatgct
ttgaagaaccaaactgtggatttggttctaactgctcatcctactcagtctgttcgcaga
tctttgctgcaaaagcatggaaggataaggaattgtttgacacaattatatgctaaggac
ataacaccagatgataagcaggaacttgatgaggctttacaaagagagattcaagctgca
tttcgcacagatgaaattcgaaggactcctcctaccccacaagatgagatgagggcagga
atgagctactttcatgagacaatttggaaaggtgtaccacagtttctgcgtcgggtagat
acagctctgaagaacattggaattaatgaacgtgtcccatataatgctcctgttattcag
ttctcttcttggatgggaggagaccgtgatggtaatcctagagtaacccctgaagttaca
agggatgtgtgtttgctggctagaatgatggctgctaatatgtacttctctcagatagag
gatctcatgtttgagttgtctatgtggcgttgcactgacgagctacgtgttcgtgctcat
gaactccataggtcctcaaagagagatgcaaaacattatattgagttttggaaacagatt
cctccaaatgagccatatcgtgttattcttggtgatgtcagagacaaactatataacatt
cgggaacgtgctcgccatttattagccaatgggacatctgatatccctgaggagacaacc
ttcactaacgttgagcagtttctggagccccttgaactatgctacaggtcactctgtgca
tgtggtgacagaccaatagcagatggaagcctccttgatttcctgcggcaagtttccaca
tttggactctcactagtgagacttgacatccgtcaagagtcagataggcacactgatgtt
atggatgcaatcacaaaacacttagacattggatcataccgagagtggcccgaggaaaag
aggcaggagtggctcttgtctgaactcagtggaaagcgccctctctttggccatgacctt
cccaaaacagaagaaatcaccgatgttttggaaacattccgtgtcatttcagagcttccc
tcagacaacttcggtgcctacatcatatcaatggcaacatccccatctgatgtgcttgct
gttgagcttttacaacgtgaatgccatgtgaagcagccactaagggtggtgccactgttt
gaaaagcttgctgatcttgaggccgctccggctgcggtggcacgtcttttctctatagat
tggtacagaaaccgcattgatgggaagcaagaagttatgatagggtactcagactcagga
aaagatgcaggccgtctttctgcggcttgggcgctttacaaggctcaagaagaacttgtg
aaggttgctaaggagtatggtgttaaacttacaatgtttcatgggagaggagggactgtt
ggaagaggaggaggtccaactcatcttgctatattgtctcagccaccagacaccattcat
ggctcacttcgggtaacggttcagggtgaagtcattgagcagtcttttggagaggaacac
ttgtgctttagaacacttcagcgcttcactgcagctacacttgagcatggcatgcatcct
cctgtgtcaccgaaacccgaatggcgtgccctcatggatgaaatggctgtcattgcaaca
aaggagtatcgctctgttgttttcaaagaacctcgttttgttgaatatttcagatgtgca
actcctgagttggagtatggaagaatgaacattggcagtcgtccatcaaagcgaaagcca
agtggaggaattgaatcactacgtgctattccttggatttttgcatggacacaaacgagg
tttcatttgccagtgtggcttggttttgggtcagcatttaagcatgtagttgagaaagat
ccgaagaatctccaaatgcttcaggacatgtacaatcaatggcctttcttcagggtcacc
ctggacttggttgagatggtgtttgctaagggagacccggggattgcagccctatttgac
aaactcctagtatcagaagagctgcgtccatttggagaaaatttaagagctaaatacgaa
gaaaccaagagctttctcctccaggttgctgggcacaaggatattcttgaaggagacccc
tacttgaagcaaagacttcgtcttcgtgactcatacatcacaaccctcaatgtgttgcaa
gcttacacattgaagcgaattcgtgatcctgactaccatgtgaagttgaggccacacttg
tcaaaggactacatggaatcaagcaagccagcagcagagcttgttaaacttaaccccaaa
agcgagtatgctcctggtcttgaggacacccttattttgacaatgaagggtattgctgct
ggaatgcaaaataccggttaa

DBGET integrated database retrieval system