KEGG   Glaciecola nitratireducens: GNIT_0010
Entry
GNIT_0010         CDS       T01632                                 

Gene name
tag
Definition
(GenBank) DNA-3-methyladenine glycosylase I
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_0010 (tag)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_0010 (tag)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     GNIT_0010 (tag)
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GNIT_0010 (tag)
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-ProteinID: AEP28170
UniProt: G4QEE2
LinkDB
Position
11224..11883
AA seq 219 aa
MTHSFTTDSGQNKLVCAWETTDPEYIAYHNEHWGRPVLNSKELFAKLCLDGQQAGLSWLT
ILRKQKNYEAAFHHFNPQDIIKMTEDDVIALMQNKGIVRNKLKIQSVIKNARAFLKIEES
IPFNAYLWQFSDFRVIQTTCKNRDDVASTSIASDAMAKALKKSGFSFVGSTICYAFMQAV
GMINDHLVTCPCHKAFCKEQAEVDKELMVLQQMAASLKP
NT seq 660 nt   +upstreamnt  +downstreamnt
atgacacattcttttacgactgatagtgggcaaaacaaacttgtttgtgcttgggaaacc
actgatcctgaatatattgcttatcacaatgagcattggggtaggccagttttaaatagt
aaagagctctttgcaaaactttgccttgatggtcaacaggctggcttaagttggctaaca
atcctgcggaaacaaaaaaactacgaagcggcattccaccacttcaatccacaagacatt
attaaaatgaccgaggacgacgttattgctttaatgcagaacaaaggaatagtgcgtaat
aaattaaaaatacaatccgtcattaaaaacgcacgcgcatttctaaagatagaagaatca
attcctttcaacgcatatctatggcaattttccgacttccgtgtgattcaaactacctgt
aaaaatagagatgatgttgcaagcacatcgattgcttcggacgcaatggctaaggcattg
aaaaaatcgggcttcagttttgtaggaagtactatttgctatgcgttcatgcaagcagtt
ggcatgataaacgaccaccttgtaacctgtccctgccataaagctttttgtaaagagcaa
gctgaagtagacaaggaattaatggtattgcaacaaatggcggctagtttaaaaccgtaa

DBGET integrated database retrieval system