KEGG   Glaciecola nitratireducens: GNIT_0064Help
Entry
GNIT_0064         CDS       T01632                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00260  Glycine, serine and threonine metabolism
gni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gni00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GNIT_0064 (tdh)
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     GNIT_0064 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 HI0933_like Pyr_redox_3 Pyr_redox_2 FAD_oxidored Pyr_redox ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AEP28219
UniProt: G4QEV6
LinkDB All DBs
Position
70530..71594
Genome map
AA seq 354 aa AA seqDB search
MNSPLKDAQAKQMKSLAKLHREPGIWMTDNPVPEIGPNDLMIKIRKTAICGTDMHIFNWD
EWSQQTIPVPMIVGHEYVGEVVEIGQEVAGFKLGDRVSGEGHITCGHCRNCRAGRRHLCR
NTTGVGVNRQGSFAEYLVLPAFNAFKIPANISDDMAAIFDPFGNAVHTALSFDLVGEDVL
ITGAGPIGIMAAAVAKHVGARYVVITDVNDYRLDLAKKMGATRVVNVASENLKDVMDELG
MTEGFDIGLEMSGVPSAFREMLDKMNHGGKIAMLGIPPQSVAVDWNKVIFKGLTIKGVYG
REMFETWYKMVSLLQSGLDLSPIITHQFSVDEFAKGFEVMGSGQSGKVLLDWQG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaccattaaaagatgcacaagcgaagcaaatgaagtctctggctaagctacac
agagaacctggtatttggatgaccgacaatcctgtgccagagattggcccgaacgattta
atgattaaaattcgtaaaacggccatttgtggcaccgacatgcatatttttaattgggat
gaatggtcacagcagacgatcccggttcctatgatcgtgggtcacgaatacgtaggtgaa
gtggttgaaatagggcaagaagttgctggttttaaactaggtgatcgtgtttcaggagaa
ggacacataacgtgtggacactgcagaaactgtcgtgcgggtcgcagacatttatgtcgc
aacactaccggtgttggcgtcaatcgacaaggctcgtttgctgaatacttagtgttgcct
gcgtttaacgcatttaagataccagcgaatattagcgatgatatggctgctatttttgac
cccttcggtaacgcagtgcataccgcattgtcattcgacctcgtcggagaggatgtattg
attacgggcgctgggccgataggcatcatggcagctgcggttgcaaagcacgttggtgca
cgctatgtggttattaccgatgtgaatgattatcgcctcgatttagcgaagaaaatgggc
gcaacacgagtggtcaacgtcgcctctgaaaacctaaaggacgtcatggacgaacttggt
atgacggaaggttttgatattggattagaaatgtcgggcgtgccttctgcgtttcgcgaa
atgctcgataaaatgaatcacggtggcaaaattgctatgttgggtattccaccgcagagc
gtcgcggttgattggaataaagtgatttttaaaggcttaaccattaaaggcgtttatggt
cgcgagatgttcgaaacatggtacaaaatggtaagcctgttgcaaagtggtttagatttg
agcccgatcattactcatcaatttagtgttgatgagtttgccaaaggctttgaagtaatg
ggttcaggacaaagcggaaaagttttattggattggcaaggatag

DBGET integrated database retrieval system