KEGG   Glaciecola nitratireducens: GNIT_0420
Entry
GNIT_0420         CDS       T01632                                 

Definition
(GenBank) Exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_0420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_0420
Enzymes [BR:gni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     GNIT_0420
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     GNIT_0420
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-ProteinID: AEP28574
UniProt: G4QJG8
LinkDB
Position
complement(463530..464294)
AA seq 254 aa
MKLVSWNVNGVRAAIKKDFLQSMASLDCDVLCLQETKAQDEQVIEALCELNGYHIFTNSA
VKKGYSGTSIITRIQPIDVTKDMGIEEHDQEGRVLCAEFSDLYLVTVYTPNSGNDLKRLS
YRAQWDADFLSYIKKLEEKKPVVICGDLNAAHRDIDLARPKPNYNKSAGYTQQEIDGIDN
LVAAGYVDTFRYVHPEKVKYSWWSYRAGARERNVGWRIDYFLVSPKLQGQIHDAEIHNDI
HGSDHCPVSVQLSI
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaagctagtatcttggaacgtcaatggcgttagggcagcaatcaaaaaagatttttta
cagtctatggcgtctcttgactgcgatgtcctttgcctgcaggaaaccaaggcgcaggac
gaacaagtgattgaagctctgtgtgagctaaatggctatcatatattcactaactcagcg
gtaaaaaaaggttattcgggtaccagtatcattactcgcatccaacccattgacgtcaca
aaagacatgggcatcgaagagcatgatcaagagggccgcgtgttatgtgcagaatttagc
gatctttatttagtcaccgtttacactccaaactcaggcaatgacttgaagcgcttgtct
tatcgggcgcaatgggatgccgacttcctgagttacataaaaaaacttgaagagaaaaag
ccggtcgtgatttgcggggatttaaatgcagcgcatcgcgatattgacttggctcgacca
aagccaaattacaataaaagcgcagggtatacacagcaggaaatagacggcatcgacaac
cttgttgccgccggttacgtggacacttttcgttatgtccaccctgagaaggtaaagtac
agttggtggagttatcgagcaggcgctagagaacgcaacgtgggctggagaattgattac
tttttagtatctcccaaattacagggacagatccacgacgctgaaattcataatgatatt
catggttcggatcactgccctgttagcgtgcaactgtcgatatag

DBGET integrated database retrieval system