KEGG   Glaciecola nitratireducens: GNIT_0718
Entry
GNIT_0718         CDS       T01632                                 

Gene name
recJ
Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
gni03430  Mismatch repair
gni03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_0718 (recJ)
   03430 Mismatch repair
    GNIT_0718 (recJ)
   03440 Homologous recombination
    GNIT_0718 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_0718 (recJ)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     GNIT_0718 (recJ)
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     GNIT_0718 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     GNIT_0718 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GNIT_0718 (recJ)
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH PIGA Glycos_transf_1
Other DBs
NCBI-ProteinID: AEP28862
UniProt: G4QFS7
LinkDB
Position
796074..797792
AA seq 572 aa
MQIQRRHAVISNPIDVQLPPILDRLYRNRGVTDVAQIQTQIKKLRHYKELKGIEKAASLI
CEAIKQELSICIIGDFDADGATSTAICMLSLKAFGHTNVHYLVPNRFDFGYGLSPEIVDV
AHQNNAEFIITVDNGISCVNGVSHAKDLGMKVVVTDHHLPGFTLPDADAIVNPNQPGCEF
LSKNLAGVGVAFYVMLAVKAKLQEQGWFEKKNIPAPNLANYLDIVALGTVADVVPLDQNN
RVLVHQGLQRIRSGIARPGIRAILDVAARPCHKLSSTDLGFVLGPRLNAAGRLDDMSLGI
ECLLTEDEQMARQMAARLDALNLERREIESSMKEEAEKALQAFMSDGNDLPAGVVLYQSD
FHQGVIGILAGRIKEKYYRPTIVFAQQDDYVIKGSARSVPGVHIRDLLETVNTQHPGLID
KFGGHAMAAGLSLQTTKLSEFKAAFETAVALATKGLPMHNLILSDGILESDEINIDNASL
IKLAVPWGQTFEEPLFDGVFQMRSQRIVGKNHLKMVVSLDGIEFDAIAFNIDLESWPNVK
TRQVKLAYKLDINEFRGQISVQLLVQALESVD
NT seq 1719 nt   +upstreamnt  +downstreamnt
ttgcaaatacagagacgccacgccgtcatttctaatcctatcgatgttcaactaccacca
attctagacaggttatatcgaaatcgaggcgttaccgacgtcgctcaaatacaaactcag
ataaaaaagctacgtcactacaaagagttaaagggaattgaaaaggctgcatcattaata
tgtgaagcaataaagcaagaattatcaatctgcattattggcgatttcgatgccgatggc
gcaaccagtactgctatttgcatgttgtctctgaaggcatttggtcatacaaatgttcat
tatttggtgccaaatcgttttgattttggatatggactaagccccgaaattgtcgatgtt
gcccatcaaaacaatgctgaatttataattaccgttgataatgggatttcgtgtgttaat
ggtgtgagtcatgcaaaggatttaggcatgaaagtggtggtcacagatcatcacttacca
ggttttacgctgcctgacgctgatgcaatagttaatcctaaccagcctggttgcgaattt
ctttctaagaatttagctggagttggcgttgctttttatgtgatgttggccgtaaaagca
aagctgcaggagcaaggatggttcgaaaagaaaaacattccagcgccgaatttggctaat
tatctcgacattgtggctttaggcacggttgccgacgttgtgccattagatcaaaataat
cgggtactagtacatcaagggctccagcgcattcgcagcggtattgcccgcccgggtatt
cgagctatattggatgttgcggccagaccttgtcataagctctcatcaaccgaccttggt
tttgtgttaggtccgcgcttaaatgctgcgggtagacttgatgacatgtctctaggtatc
gagtgcttgctgacagaagatgaacaaatggcacggcaaatggctgcgcgattagacgca
ttgaacttagagcgtcgtgaaattgaatcatcgatgaaagaagaagctgaaaaagcactt
caggcttttatgtctgatggaaatgacttacctgctggtgttgttctttatcaatcagac
tttcatcagggcgttatcgggatattagcgggcagaatcaaagagaaatactatcgaccc
actattgtctttgcgcagcaagacgattacgtcattaaaggctctgctaggtcagttcca
ggcgttcacattcgcgatttgttggaaacggtaaatacgcagcacccgggtttaattgat
aagtttggtggccacgcgatggctgcaggactcagcttacaaacaacaaaattaagcgag
tttaaagcagcctttgagactgcggttgcgctggcaacgaaaggtttaccaatgcataac
ttgattttgtctgacggtatcctagaaagtgacgaaatcaatattgataacgctagtctt
attaagttggcggttccttggggacaaacctttgaggagccattatttgacggggtattt
caaatgcgcagccagcgcattgttggtaaaaaccacttaaaaatggtcgttagtttagac
ggcatagaattcgacgctattgctttcaatattgacctagaatcatggccaaatgtcaaa
actaggcaagttaaactggcttataagttggatattaatgaatttaggggccaaatcagt
gtacaattgttggtccaagcgctcgagtcagtcgattga

DBGET integrated database retrieval system