KEGG   Glaciecola nitratireducens: GNIT_0746Help
Entry
GNIT_0746         CDS       T01632                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00620  Pyruvate metabolism
gni00680  Methane metabolism
gni01100  Metabolic pathways
gni01120  Microbial metabolism in diverse environments
gni01200  Carbon metabolism
Module
gni_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GNIT_0746 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    GNIT_0746 (ppc)
Enzymes [BR:gni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GNIT_0746 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEP28890
UniProt: G4QJ22
LinkDB All DBs
Position
complement(819377..821986)
Genome map
AA seq 869 aa AA seqDB search
MNDSLDAQLKDTVRYLGATLGETIEAELGSEWLQKIEQIRQDGRDSYADDTKSTDRLTAL
FSSLDNQSLLTIGRAFAQFLNLANIAEQEYNSANQRDESLASSLEKIKTIATDKEKVIAA
VKSLNIDLVLTAHPTEVTRRTLIHKHRQLAAQLEAMHAPDLSSKDRGKIKNRIAALISQA
WHTEEIRSVRPTPVDEARWGFSVIESSLWEAVPEFLRELEEYLKAEFDITLPLDAKTVQI
GSWMGGDRDGNPFVTSKVTEEVLMLARRRAAKLFALDMDDLYIELSMNDCNDKLRDMVGD
AKEPYRAALKAIRNKLEKTRDNLLPLEEWVANNDELLTPLLACYESLHECGMAVIAEGVL
KDTIRRVHCFGVNLLQLDIRQDSDRHADVFSELTRYLGLGDYAQWSEDDKQAFLLRELSS
KRPLIPRNWQPSEDVQEVLDTCAVISRHSRESFGIYIISMAREASDVMAVQLLLKEAGLS
WPMPVAPLFETLDDLNNSPKVMRNLLDIDWYRGYIKGRQYVMIGYSDSAKDAGSLAAGWA
QYESQEALVALAEEKSVNLTLFHGRGGTIGRGGLPAKAAIHSQPPGSLTGGFRVTEQGET
IRYKFGMPQLAKRSLSIYAAAVVEAMLCPPPAPKPLWRETITKMAAQARDNYRGVVREDP
EFVPYFRVATPEQELGKLPLGSRPAKRNPQGGIESLRAIPWIFAWAQTRMVLPSWLGVMK
AVESVIEDGSEEAVKDMIDNWPFFNSRLSMLDMVFKKAEPHISAAYDARLVPDNLKHFGE
GLRAELKQSIASILRILDHTDMMEDDPHGKLSMEIRGGYLEPLHYLQIELLDRIRKEGSS
DYNDNDTATLEMAMMVTITGIAIGLRNTG
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattcgctcgacgcacaattaaaggatacggtacgttatttgggtgcaacactt
ggtgaaaccattgaagctgaattaggcagcgaatggctacaaaaaatagagcaaatcaga
caggacggccgcgattcttatgccgatgatacaaaaagcacagatcgcctcaccgcctta
ttttcaagtttagataatcagtctctattaacgataggacgagctttcgctcagttctta
aatttagccaatattgctgagcaagaatataacagcgcaaatcagcgtgatgaatcgctc
gcttcgtcactcgaaaaaattaaaaccatcgccacagataaagaaaaagtcatcgctgcg
gtgaagagtctcaatattgacttagtattaacggcacaccctacggaagtgactcgccgc
actctcattcataagcacaggcagctggccgctcagcttgaagcaatgcatgcacctgat
ttgagcagcaaagaccgcgggaagatcaaaaatcgcattgcagcgttaataagccaagca
tggcacactgaagagatacgttctgtgcgcccaacaccggtagatgaagctcgctggggc
ttctctgtgattgaaagctcgttatgggaagcggtacctgagttcttacgtgagttagaa
gaatacctaaaggccgaattcgacattaccctgccgctcgacgctaaaacagtgcaaata
ggttcttggatgggcggcgatcgcgatggcaatccattcgtcacctcaaaggtaaccgaa
gaagttctcatgcttgctcgacgcagagctgctaagttattcgccctagatatggatgat
ttgtatattgaactctccatgaatgactgcaatgacaaattgcgcgatatggttggtgat
gcgaaagaaccctatagagctgcgctaaaagcgattagaaacaaattagagaaaacacgt
gacaacctgctccctttagaagaatgggtcgcaaacaatgatgagctgttaacaccctta
ttagcctgctacgaatcattgcatgaatgcggcatggcagtcattgctgaaggtgtgttg
aaagacaccattcgtcgagtacactgctttggtgtgaatttgttgcaattggatattcgt
caggattcagatcgccacgccgacgtattcagcgaactcactcgctatcttgggctcggt
gactacgcgcaatggagtgaagacgataaacaggcattcttactgcgtgaacttagctct
aaaagacccctgatcccgcgaaactggcagccaagcgaggacgttcaagaagtcttggat
acttgcgctgtgatatcgcgccacagtcgagaaagttttggtatttacattatatccatg
gcaagagaagcatccgatgttatggctgttcagttgctattgaaagaagcaggcttgagt
tggccaatgcccgtagctccgctgtttgaaaccctcgatgatttaaataattcaccaaaa
gtcatgcgtaatttgctcgatattgactggtatagaggctacatcaaaggtcgtcagtat
gtcatgatcggctattctgattcagcaaaagacgcaggctcgctcgctgcaggctgggca
caatatgagtcacaagaagccttagtcgcgcttgccgaagaaaagtcagtaaatcttacc
ttgtttcacggtcgtggcggcacaattggtcgcggtggattaccggcgaaagccgctatt
cactcacagcctcctggctcactgaccggcggattcagagtaaccgaacagggcgaaact
attcgctacaaattcggtatgccgcagttggctaaacgcagtttgtctatatacgcagcg
gcagttgttgaagcaatgctttgcccgccaccagcccctaagcctctgtggcgagaaacc
ataacgaaaatggcagcgcaagcacgtgacaactaccgcggtgttgtgagagaagaccca
gagtttgtcccctacttccgcgtggcaactcctgagcaggaacttggcaaactgccgctt
ggaagccgtccagctaaacgtaatccacagggcggtatcgagagcttgcgggctattcca
tggatattcgcatgggcgcaaacgcgtatggtgttgccgtcttggttaggcgttatgaaa
gcggttgaaagtgttatcgaggacggtagtgaagaagcggtcaaggatatgattgataac
tggccgttctttaattcaagattgtctatgcttgatatggtgttcaaaaaagctgagcct
catatcagcgcagcttacgacgcacgattagtgcctgacaatctgaaacacttcggcgaa
ggcttgcgcgctgagcttaaacaaagcattgcttcgatactgcgcattctagatcatacc
gacatgatggaagatgacccgcacggcaaactgtcgatggagatccgtggcggttacctc
gagccattgcattacttgcaaatagagttgttagaccggatccgtaaagaaggatcgtct
gattacaacgataacgacaccgcaactttagagatggcgatgatggtaactattacgggt
attgctattggtttacgtaacactgggtaa

DBGET integrated database retrieval system