KEGG   Glaciecola nitratireducens: GNIT_2055
Entry
GNIT_2055         CDS       T01632                                 

Definition
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03030  DNA replication
gni03410  Base excision repair
gni03420  Nucleotide excision repair
gni03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GNIT_2055
   03410 Base excision repair
    GNIT_2055
   03420 Nucleotide excision repair
    GNIT_2055
   03430 Mismatch repair
    GNIT_2055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gni03032]
    GNIT_2055
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_2055
Enzymes [BR:gni01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     GNIT_2055
DNA replication proteins [BR:gni03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     GNIT_2055
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     GNIT_2055
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     GNIT_2055
   MMR (mismatch excision repair)
    DNA ligase
     GNIT_2055
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GNIT_2055
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD PTCB-BRCT HHH DZR_2
Other DBs
NCBI-ProteinID: AEP30164
UniProt: G4QLQ8
LinkDB
Position
complement(2277958..2279985)
AA seq 675 aa
MTELNKVKAHIDALKSQLEEHNYQYYVMDAPSIPDAEYDRLMRELITLEKQNPALISADS
PSQKVGGTPLSKFDTVVHEVPMLSLDNGFEASDLTAFEKRLQDRLLSFSDIQFSCEPKLD
GLAASILYENGILTRAATRGDGQVGEDITKNVKTIANVPIKLRGENIPSKVEVRGEVFMP
KAGFEKLNETQKKAGNKLFANPRNAAAGSLRQLDSRITAKRPLLFYAYSMGVIEGESLTD
LPLHTERLAALGKWGIPLCKESAIANGAEECIAYFTKIGQMRNSLPYDIDGVVFKVNDIN
LQQRLGFVSKAPRWAIAQKFPAQEELTTLLDVEFQVGRTGAITPVARLEPVFVGGVTVSN
ATLHNQDEIARLGVKIGDKVVIRRAGDVIPQVVSVVLEKRTDDVRDIVFPTHCPVCHSHI
ERTESEAVARCTGGLVCAAQRKESIKHFASRKALDIDGLGDKIVEQLVDANMIKNPADLF
RLNMPKLLSVERMGDKSAVNLLNAIEKSKQTTLPKFLYSLGIREVGESTARNLALHYLTL
ERIMQADIESLVEVQDVGAIVAQHVFHFMREPHNVDIINDLFELGIHWPEIQPASLDEQP
FAGKTIVLTGTLSQMGRSEAKAKLQELGAKVSGSVSAKTDLLIAGEKAGSKLSKAESLNI
EVWNEAQMVAFFEQL
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgactgaactaaataaagtgaaagcgcacattgatgcgcttaaatcgcagctagaagaa
cacaattaccaatactacgttatggatgcacccagcattcctgatgcagaatatgatcga
ttaatgcgggagcttattactcttgaaaagcaaaatccagccttaatcagtgccgattct
ccgagtcaaaaagtaggcggcacgccattatctaaatttgatacagttgtgcatgaagtc
ccgatgctgtcgcttgacaacggctttgaagcgtctgatttgactgcatttgaaaaacga
ctgcaagacagattactttcattttctgacattcagttcagctgtgaacccaaacttgat
ggcttagctgcctctattctttatgaaaacggcatactcaccagagctgcaacaaggggt
gacgggcaagttggtgaagatattacaaagaatgtcaaaaccattgccaacgtgcccatt
aagctgcgcggggaaaatataccgagtaaagtcgaagtccgaggcgaagtgtttatgccg
aaagcgggttttgagaagctcaatgagacacaaaagaaagccggaaataaactattcgct
aatccaagaaatgcggcggcaggcagcttgcgtcaacttgattcgcgaattacggcgaaa
cgaccgctactgttttatgcctatagtatgggcgttattgagggggagagtcttaccgac
ctgccgttgcataccgaacgactagccgcactcggtaagtggggcatccctttatgtaaa
gagtctgcgattgctaatggcgccgaagagtgtattgcctattttacgaaaataggtcag
atgcgcaattcgctaccatatgacattgatggtgttgtgtttaaagtcaacgatattaac
ttacagcagcgtctgggcttcgtttcaaaggcgccgcgctgggccattgcacaaaagttt
ccagcgcaagaggaattaaccaccttactcgacgttgagtttcaagttggccgcacaggc
gcgattacccctgtggctaggttagaaccagtttttgtcggtggagttaccgtatctaat
gcgacgctgcacaatcaagatgaaattgctcgtttgggcgttaaaatcggtgacaaagtg
gttattcgacgtgcgggagatgtgatcccgcaggttgtgtctgttgttttagaaaaacgc
acagatgatgttcgtgatatcgttttccccacgcattgccctgtttgtcattcgcacatc
gagagaacggaatcagaggccgttgctagatgtactggcggtctggtctgcgcggcacaa
cgaaaggaatctattaagcattttgcttcgcgtaaagctctcgacattgatggtttagga
gacaaaatcgttgagcagctagtagacgcaaacatgattaaaaatcctgccgatttgttt
agattaaatatgcctaagttgctctcagtagagaggatgggggataagtccgctgttaac
ctcctcaacgcaatcgaaaagtcaaaacaaacaaccttgcctaagtttctctattctctg
ggaataagagaagtgggtgagtcaaccgcacgcaatttagcactacactatttgactcta
gaacggattatgcaagcagatatagaatcattggtagaagtgcaagatgttggtgccatt
gtagcgcagcatgttttccactttatgcgagagcctcacaacgtagatataatcaatgat
ttgtttgagctaggaattcattggcccgaaatacagccagcgtcactagatgaacagccg
tttgctggaaaaacgattgtgctaaccggaacgttatcgcaaatgggccgaagcgaggct
aaggcgaagctacaggaactgggcgcaaaagtgtcgggcagtgtatcggctaaaacggat
ctgctaattgctggcgaaaaagcgggttcaaagttgagtaaggctgaatcgttgaatata
gaggtttggaatgaagctcagatggtggcttttttcgagcaactttaa

KEGG   Glaciecola nitratireducens: GNIT_2788
Entry
GNIT_2788         CDS       T01632                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03030  DNA replication
gni03410  Base excision repair
gni03420  Nucleotide excision repair
gni03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GNIT_2788
   03410 Base excision repair
    GNIT_2788
   03420 Nucleotide excision repair
    GNIT_2788
   03430 Mismatch repair
    GNIT_2788
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gni03032]
    GNIT_2788
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_2788
Enzymes [BR:gni01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GNIT_2788
    6.5.1.6  DNA ligase (ATP or NAD+)
     GNIT_2788
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GNIT_2788
DNA replication proteins [BR:gni03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    GNIT_2788
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     GNIT_2788
DNA repair and recombination proteins [BR:gni03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GNIT_2788
   NER (nucleotide excision repair)
    Other NER factors
     GNIT_2788
   MMR (mismatch excision repair)
    Other MMR factors
     GNIT_2788
SSDB
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M mRNA_cap_enzyme
Other DBs
NCBI-ProteinID: AEP30885
UniProt: G4QIH1
LinkDB
Position
3089564..3090457
AA seq 297 aa
MIFYSKFSIAKAILLLLASFVLALFLATESAQAFNDTSLPNVQLAEVYDKQNVQDYLISE
KYDGVRAIWKDRTLQSRSGNIIHAPTWFTEGLPDVWLDGELWYRRGDFEYVVSTVNKDIP
VNSEWKNITYMVFDAPNYNADFQSRATFYTSLIQSLHLAHVKAVDQFSLTTNAELSAYLK
NYVAEGAEGLMLQKADAKFADGRSSNLLKLKPYMDAEARVLAHLEGKGKYRDKVGAILVL
YSNASGSKITFKIGSGFSDEERANPPPIGSVVTFKYHGFTKRGVPRFASYLRMYKPS
NT seq 894 nt   +upstreamnt  +downstreamnt
atgatcttttattctaaattctcaattgcaaaagcaatattgttattgttggcatctttt
gtattagcgctgtttttagcaactgagagcgcacaagcttttaacgacacaagcctaccc
aatgtgcagcttgcagaagtatatgataagcaaaatgtgcaagattaccttatcagcgaa
aagtatgacggcgttcgtgccatttggaaagatcgcaccctgcaatcgcgaagcggaaat
attattcatgctccaacttggtttaccgagggattaccagacgtttggctagacggtgaa
ttgtggtatcgaagaggagatttcgaatatgtggtttcaaccgtcaacaaagatattcct
gttaatagcgaatggaaaaacattacttacatggtgtttgatgcgccaaactacaacgcc
gactttcaaagcagagcaactttctataccagcttaatacagagtttacaccttgcgcat
gtaaaagccgtcgaccaatttagcttaactacgaatgcagagttatctgcttatttaaaa
aattatgtcgcagagggagctgaagggttaatgctacaaaaagctgatgccaaattcgcc
gatggacgcagtagtaatttgctcaagctcaaaccatatatggacgccgaagcacgggta
ttagctcacttagagggaaaaggtaaataccgggacaaagttggtgcgatactggtgctt
tattctaacgcgtcaggcagtaaaattacgttcaagattggtagcgggtttagtgatgag
gaaagagctaatccgccaccaataggcagcgttgttactttcaagtatcacggctttact
aaacggggcgtgcctcgttttgccagctacttgcgaatgtataagccatcgtaa

KEGG   Glaciecola nitratireducens: GNIT_3081
Entry
GNIT_3081         CDS       T01632                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03030  DNA replication
gni03410  Base excision repair
gni03420  Nucleotide excision repair
gni03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GNIT_3081
   03410 Base excision repair
    GNIT_3081
   03420 Nucleotide excision repair
    GNIT_3081
   03430 Mismatch repair
    GNIT_3081
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gni03032]
    GNIT_3081
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_3081
Enzymes [BR:gni01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GNIT_3081
    6.5.1.6  DNA ligase (ATP or NAD+)
     GNIT_3081
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GNIT_3081
DNA replication proteins [BR:gni03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    GNIT_3081
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     GNIT_3081
DNA repair and recombination proteins [BR:gni03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GNIT_3081
   NER (nucleotide excision repair)
    Other NER factors
     GNIT_3081
   MMR (mismatch excision repair)
    Other MMR factors
     GNIT_3081
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase CobD_Cbib
Other DBs
NCBI-ProteinID: AEP31176
UniProt: G4QIM1
LinkDB
Position
3424998..3426623
AA seq 541 aa
MDAFSRLVDQLYFTSSNLAKSAILRDYLRTTPNPDRGWAIAAIAGTLNFDLFKRKLIKDL
ITARVDPVLFDLSYDYVGEMSETVAHLWPSTGEATKELSKNVSLPSLHELVVLFKQSNKQ
QVEEILVSLLDRMTAPQRWALIKLGTRGLRIGLSARFLKKVLAEYANELPQNNISTEDIE
RVWHGVEPPYLDLFDWLEGKADKPDVSKKITFQPVMLSHPLSDNELTIISSEHWQAEWKY
DGIRVQLVCNENGKALFSRTGDDISGSFPDLLDSIDETRVSGVFDGELLAMQDEQINSFN
QLQQRLNKKKPSKKLMQEIPVGMMLYDALVINGSDLREKALRIRSSQLTAWYELQSNRLL
KLSVPLVFNNIEELRALREKANISDNGYIEGLMLKNKDSIYVAGRPKGQWYKWKRDAKLV
DAVIMYAQRGHGKRSSFYSDYTFGCWQDDKLFPIGKAYSGFTDDELKQLDKWIRNNTIGR
FGPVKEVKKELVFEVAFDSVHHSKSHKSGVALRFPRIHRIRWDKPASEADQLTTLVSLIE
K
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggacgcgttttcgaggcttgttgatcaactctactttacctctagcaacttagctaaa
tcagctattttgcgcgactacttgcgcacaacgccaaatccagatagaggttgggcgata
gccgctattgccggcactctcaattttgatttattcaagcgaaaactcataaaggatttg
ataaccgctcgcgttgatcccgtattgttcgatttatcatatgattatgtgggtgaaatg
agtgaaaccgttgcccacttgtggccaagcactggcgaagcaacgaaagagctttcaaaa
aatgtatcattacccagtttgcatgagctcgtcgtgctttttaaacaaagcaacaagcag
caagtagaagagatcttggtaagcctactagaccgaatgaccgccccgcagcgctgggcc
ttaattaagttaggcacacgcggtttacgtatcggtttatcagcccgattcctaaagaaa
gtattggcggaatacgccaacgaattaccgcaaaataatataagcaccgaagatattgaa
cgagtatggcatggcgtggaaccaccctatctcgacttgtttgactggttggagggtaaa
gcggataaacccgatgtatcaaaaaagattacgtttcagccggtcatgctctcccacccg
ctaagtgacaacgaactcacaattatttcatcagagcattggcaagccgagtggaaatat
gacggaatacgtgtgcagttagtctgcaatgaaaacggtaaagccttgtttagccgcaca
ggcgacgatattagcggcagttttcctgaccttctcgatagtattgatgagacgcgtgta
tctggcgtatttgatggcgagctactagcgatgcaagacgagcagattaatagcttcaac
caacttcagcagcgtttgaataaaaagaagcctagcaaaaaattgatgcaagaaattccc
gttggaatgatgctttatgatgccttagtcattaacggtagcgacctaagagaaaaagca
ttgcgaatacgcagctcgcaattaacagcttggtatgaactacaatcaaatagactcttg
aagctttccgtccctctagtttttaacaatattgaagaacttcgagcccttcgtgaaaaa
gctaatatctctgacaacggctacattgaggggctcatgctaaagaataaagacagtatt
tatgtcgcaggcagacccaaaggtcaatggtacaaatggaagcgagatgcgaagctagtg
gacgccgttatcatgtatgcacagagaggacacggcaaacgatcttctttctattctgac
tacacctttggttgctggcaggatgataagttattccccataggaaaggcctatagtggt
tttactgatgatgagttgaagcaactcgataaatggataaggaacaataccattggacgt
tttgggccggtgaaagaggtaaaaaaggaattggtttttgaagtcgcgttcgactctgtt
caccattctaaaagtcataagtcgggcgttgcacttcgctttcctagaattcatcgaata
aggtgggacaaaccagcaagtgaggctgaccaactaaccactctagtatcgctgattgag
aagtag

DBGET integrated database retrieval system