KEGG   Glaciecola nitratireducens: GNIT_2250
Entry
GNIT_2250         CDS       T01632                                 

Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_2250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_2250
Enzymes [BR:gni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GNIT_2250
DNA repair and recombination proteins [BR:gni03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GNIT_2250
 Prokaryotic type
     GNIT_2250
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: AEP30351
UniProt: G4QKP8
LinkDB
Position
2492823..2493482
AA seq 219 aa
MNKEKRHEMLSRLRANNPHPTTELNFSSPFELLIAVILSAQATDVSVNKATDKLYPVANT
PEAIYALGIDGLKEYIKTIGLFNSKTKNVIETCRILIEDHGSVVPENREALEALPGVGRK
TANVVLNTAFGWLKDNKGKYFIAVDTHIQRVANRTGYAKGKTVEETERNIIKNTPNKTEF
MYDLHHWLILHGRYTCIARNPRCGSCIIEDLCDYKDKTE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaacaaagagaaacgtcatgaaatgctctctcgcttgcgcgctaataacccccaccca
accactgagctaaatttttcaagtccattcgaattgcttatcgcggtaattttgtcagca
caggccactgacgttagcgttaacaaagcgacagacaaactttaccctgtggcgaatacg
cccgaagcaatctatgcactaggtatcgatggtttaaaggaatacataaaaaccataggg
ttatttaattcaaaaactaaaaatgtcattgaaacttgccgtattttgattgaagaccat
ggttcagttgtgccagaaaacagagaggctttagaagcattgcccggcgttggcagaaag
actgctaatgttgttttaaatactgcctttggctggctaaaagataataaaggtaaatac
ttcatcgcggttgacacacacattcaaagagtagctaatcgcacgggttatgctaagggt
aagacggttgaagaaaccgaacgaaacatcattaagaacacccctaacaaaactgaattt
atgtatgacctacaccattggttgatattacatggcaggtatacatgtattgccagaaac
cctagatgtggttcgtgcattattgaagacttgtgtgattacaaagataaaaccgaataa

DBGET integrated database retrieval system