KEGG   Glaciecola nitratireducens: GNIT_2702Help
Entry
GNIT_2702         CDS       T01632                                 

Gene name
ftsI
Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00550  Peptidoglycan biosynthesis
gni01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:gni00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GNIT_2702 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    GNIT_2702 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gni01011]
    GNIT_2702 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gni03036]
    GNIT_2702 (ftsI)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GNIT_2702 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:gni01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   GNIT_2702 (ftsI)
Chromosome and associated proteins [BR:gni03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    GNIT_2702 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer TMCO5
Motif
Other DBs
NCBI-ProteinID: AEP30799
UniProt: G4QME7
LinkDB All DBs
Position
complement(2993570..2995375)
Genome map
AA seq 601 aa AA seqDB search
MAGNANRRVSAKRATSKDRQAKQNTSPMLMQWRFLTILFSVILVFVCLAARAAFIQVIEP
DLLIQQGDNRTIRVRDNPSYRGLITDRHGEQLAVSVPSKAIWADPKVVNAFDSDTGETQS
LDTRRFQALAEVLGRDVQSLYDKVDNPKRRFVYIQRQVTPAMANFVEELAIPGIYLRNES
KRYYPTGEVSSHVIGFTNVDDKGIEGIEKLYNDWLTGTPDKRKIRRDAKGRQVEIIEQHA
GEKAGDLMLTIDQRIQALAYRELKEATLYFKAASASVVIVDVHTGEILALANTPSYNPND
RATVSNHRLRNRAITDAFEPGSSLKPIAVLAALEYGTVQKDSIVDTSPGWMRLGGSRVED
PRNYGKITLTEIIQKSSNMGTSKLALSVDKNFLMDTYYNMGLMSDTGTNMVGESNGIFHE
RNRWSEHELSSLSFGYNISVTTAQLARMYATIANGGVKVPLSIIKSNEPALELPERVVSH
ENAMAVLEMMESVTQEGGSGTKARVPGYRVAGKTGTSRKAVAGGYGEEYVNIFAGIAPVS
DPQIAVVVLINEPGGDLYHAGDTAAPTFSAIVSGTLQMLNVPPDDNAKTASIHRGGQHDV
Q
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaacgcgaatcggcgtgtatctgctaaaagagcaacaagcaaagaccgccaa
gccaaacaaaatacgtctcctatgctcatgcaatggcgttttctcacgatcttgtttagc
gtgatattagtctttgtttgtttagccgcaagagccgctttcattcaggtaatagagccc
gatctattaatccaacaaggcgataatcgcactattcgagtgcgtgataatcccagctac
cgcggtttgataaccgatagacacggcgaacagctcgctgtaagcgtaccttcaaaagca
atatgggccgatccgaaagtagtcaacgcctttgatagcgataccggtgaaacgcagtca
cttgatactcgccgattccaagcgctggctgaagtgttaggtcgagatgtgcaaagtctt
tatgacaaggtcgataatccgaagcgccgatttgtatatattcaacgccaagtaacgcca
gcaatggctaattttgttgaagagttggctatccccggtatctatttgcgtaatgaatct
aaacggtattatccgaccggagaagtttcttcgcatgtcatcggctttaccaatgtcgat
gacaaaggtattgaaggcattgagaaactgtataacgactggttaacaggcacacccgat
aaacgtaaaattcgtcgtgatgcaaagggccgtcaagttgaaattattgagcagcacgcc
ggtgaaaaagccggtgatttaatgctgactattgatcaacgcattcaagcgctcgcttac
cgcgaacttaaagaagcgacactttactttaaagcagcgtcggcatcagtggtgattgtt
gatgtgcatacgggtgaaattctcgcgttagcgaatacgccatcatataacccaaacgac
cgtgcaacagtatcaaatcaccgcttacgcaacagagcgataacggatgcttttgagccc
ggttcatcactaaagccaattgcagtactagctgcattggaatatggcacggttcaaaaa
gactctattgttgacacatcacccggttggatgcgtttgggcggcagccgagtggaggac
ccgcgcaactatggaaaaattactcttacagaaattattcagaaatctagcaacatgggc
acctcgaagttggcgttgtcagtagacaaaaactttctcatggatacctattataatatg
ggcttaatgagcgataccggcaccaacatggtgggagaatcaaacgggatttttcacgag
cgtaaccgttggtctgagcacgagctgtcatcgttatcattcggctacaatatttcggtc
acgacggctcagcttgccagaatgtatgcaactatcgcaaacggcggagtaaaagtaccg
ttgtcgattattaagtcgaacgagccagcattagaattaccagagcgcgtcgttagccat
gaaaatgcaatggctgtattggaaatgatggaaagcgtgacgcaggaaggtggctctggc
acaaaagcaagagtacctggttatcgtgttgcgggtaaaaccggaacgagcagaaaggcg
gtagctggcggatacggagaagaatacgttaatattttcgcgggtattgcccccgtttct
gatccacagatagcagtggttgtgttgatcaacgaaccaggcggcgacttatatcacgct
ggcgacacagcggcacctacgttttcagcgatagtgtcgggtacgttgcaaatgctgaat
gtgccgcctgacgacaacgcgaagaccgcgagtatccacagagggggtcagcatgacgtc
caatga

DBGET integrated database retrieval system