KEGG   Glaciecola nitratireducens: GNIT_2721Help
Entry
GNIT_2721         CDS       T01632                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
gni  Glaciecola nitratireducens
Pathway
gni02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gni00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GNIT_2721 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gni02000]
    GNIT_2721 (pstB)
Enzymes [BR:gni01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     GNIT_2721 (pstB)
Transporters [BR:gni02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    GNIT_2721 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 ABC_ATPase NB-ARC AAA_15 AAA_29 AAA_25 AAA_16 ATP-synt_ab AAA_23 AAA_7 NACHT AAA_13 ATPase_2 RNA_helicase AAA_33 Rad17 MMR_HSR1 AAA_18 AAA_28
Motif
Other DBs
NCBI-ProteinID: AEP30818
UniProt: G4QMP7
LinkDB All DBs
Position
complement(3014300..3015106)
Genome map
AA seq 268 aa AA seqDB search
MLKLFETETLSLDDLTDEQTAIKVQDFSVWLNDSLVLNKINMCIPKNKITAMIGQSGCGK
STLLSSLNRMNELNQKYAFSGEVLLDGRDIYNKKENVAKLRTTVGMVFQRPNPFPMSIYE
NVCFGLRIQGKTERRMLDDIVERSLRNAALWDEVKDRLFDSALLLSGGQQQRLVIARALA
LKPEVLLLDEPTSALDPLTTLHIEELINQLKKTTTVIIVTHNMQQAARVSDYAAFLHQGE
LIEYSDSDSLFTMPDKKQTEDYITGRYG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaactctttgaaactgaaactctgtctcttgatgatcttaccgatgagcaaaca
gccatcaaagtgcaggatttcagcgtgtggttaaatgacagtctcgtattgaacaagatc
aatatgtgcattccgaaaaataaaatcacggcaatgatcgggcaaagtggctgcggcaaa
tcaaccctgttgagcagtttaaatcgaatgaacgaactcaatcaaaagtatgcttttagt
ggcgaagtattgttagacgggcgtgacatttacaataagaaggaaaatgtcgccaagttg
cgcacgacagttgggatggttttccaacgaccaaatccattcccaatgagcatatatgaa
aatgtgtgttttggacttcgaattcaaggcaaaactgaacgcagaatgcttgatgacatt
gttgaacgttctctgcgcaatgcggcactgtgggacgaagtaaaagaccgtttgtttgat
tcagcacttttgctctcaggtggccagcagcagcgtttagttattgcaagagcactcgca
ctgaaacctgaagtgctgttacttgatgaaccgacatcggcgcttgatccgctgaccact
ttgcatatcgaagaacttattaatcaactcaaaaagacaacaacagtgattattgttaca
cacaacatgcagcaagcggcgcgggtttctgattatgctgcgtttctgcatcaaggcgag
cttatcgaatattccgatagcgattcgttatttaccatgccagataaaaaacaaactgaa
gactatataaccggccgctatggttag

DBGET integrated database retrieval system